Glyma15g18250 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g18250

Feature Type:	gene_model
Chromosome:	Gm15
Start:	14920582
stop:	14923248
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g18250

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G31550	AT	Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 11 \| chr4:15290065-15291458 REVERSE LENGTH=325	SoyBase	E_val: 1.00E-91	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF03106	PFAM	WRKY DNA -binding domain	JGI		ISS
PF10533	PFAM	Plant zinc cluster domain	JGI		ISS
UniRef100_A7LHH9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WRKY42 (Fragment) n=1 Tax=Glycine max RepID=A7LHH9_SOYBN	SoyBase	E_val: 8.00E-175	ISS
UniRef100_I1MH56	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MH56_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma15g18250

Locus	Gene Symbol	Protein Name
	WRKY42	WRKY Transcription Factor

Expression Patterns of Glyma15g18250

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g18250

Paralog	Evidence	Comments
Glyma09g06980	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g18250 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g168200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g18250

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g18250

Limit To All Plant Sequences

>Glyma15g18250.1   sequence type=CDS   gene model=Glyma15g18250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGCATTGGATATGATAGATGTTGTTCCGAGAACGAGGATGGAGGAAGCTGCTTCCGCTGGATTAAAGAGCATGGAGCATCTCATTCGACTCCTTTCTCCAACCTCTTCTAATTCCAATTCTTCTTCTTCTCCTCTTCTCAATACCAATCCCAACAACCTCCACTGCTCCCAAATCACCGACTTCACCGTCTCCAACTTCAAACAAGTCATCAACCTTCTCAACCGCACCGGCCACGCCCGCTTCCGCCGCTCTCCACCCCAAGCCCAAGCCCAAGCCCAAACCCAAACCCAAACCCAAACAAGTCTTCAGCCTCAACCAGAAACCCAACAAGGGTTCAGTTTAGATTTCGTGAAGCCCACCATTCTAAACTCAAAACCCAGCAACAAAGACGAGACTTTGACCCTCTCCACCACCTCCTCCTCCTCCTTCACGTCCTCCGTCACCAACGACGCCAGCGTCTCCGACGGCAAGATCGGCCCTTTCCTCCCTCCCTCCGCCGCCAAGCCACCTCTCTCCTCCGCCCACCGGAAAAAGTGCCGCGACGCTGCCGCCGCGCTCTCCACCAAACCCTCCTGCCACTGCTCCAAGAAAAGGAAATCACGCGTGAAACGAACGATTCGTGTGCCGGCGGTAAGCTCCAAGATCGCCGATATCCCATCGGACGAGTACTCGTGGAGAAAATACGGTCAAAAACCGATCAAGGGTTCACCTTACCCTCGAGGGTACTACAAGTGCAGCACCGTGAGAGGGTGTCCGGCGAGGAAGCACGTGGAGCGAGCGCAAGATAACCCCAAGATGCTAATAGTGACTTACGAGGGTGAGCACCGTCACGTTCTTCCGTTAACTGCCGCTGCCGGCGTTAGTTTCGGCCATTAA

Predicted protein sequences of Glyma15g18250

Limit To All Plant Sequences

>Glyma15g18250.1   sequence type=predicted peptide   gene model=Glyma15g18250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMALDMIDVVPRTRMEEAASAGLKSMEHLIRLLSPTSSNSNSSSSPLLNTNPNNLHCSQITDFTVSNFKQVINLLNRTGHARFRRSPPQAQAQAQTQTQTQTSLQPQPETQQGFSLDFVKPTILNSKPSNKDETLTLSTTSSSSFTSSVTNDASVSDGKIGPFLPPSAAKPPLSSAHRKKCRDAAAALSTKPSCHCSKKRKSRVKRTIRVPAVSSKIADIPSDEYSWRKYGQKPIKGSPYPRGYYKCSTVRGCPARKHVERAQDNPKMLIVTYEGEHRHVLPLTAAAGVSFGH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain