SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g18183): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g18183): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g18183

Feature Type:gene_model
Chromosome:Gm15
Start:14810143
stop:14811893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g18183
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G29900AT Annotation by Michelle Graham. TAIR10: autoinhibited Ca(2+)-ATPase 10 | chr4:14611225-14618775 REVERSE LENGTH=1069 SoyBaseE_val: 1.00E-39ISS
GO:0006754GO-bp Annotation by Michelle Graham. GO Biological Process: ATP biosynthetic process SoyBaseN/AISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006882GO-bp Annotation by Michelle Graham. GO Biological Process: cellular zinc ion homeostasis SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009624GO-bp Annotation by Michelle Graham. GO Biological Process: response to nematode SoyBaseN/AISS
GO:0048281GO-bp Annotation by Michelle Graham. GO Biological Process: inflorescence morphogenesis SoyBaseN/AISS
GO:0048367GO-bp Annotation by Michelle Graham. GO Biological Process: shoot development SoyBaseN/AISS
GO:0070588GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transmembrane transport SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0005388GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium-transporting ATPase activity SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24093Panther FAMILY NOT NAMED JGI ISS
PTHR24093:SF73Panther SUBFAMILY NOT NAMED JGI ISS
PF00689PFAM Cation transporting ATPase, C-terminus JGI ISS
UniRef100_G7IGB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plasma membrane calcium-transporting ATPase n=1 Tax=Medicago truncatula RepID=G7IGB8_MEDTR SoyBaseE_val: 7.00E-55ISS
UniRef100_UPI000233B610UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B610 related cluster n=1 Tax=unknown RepID=UPI000233B610 SoyBaseE_val: 3.00E-81ISS

Expression Patterns of Glyma15g18183
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g18183 not represented in the dataset
Glyma15g18183 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g18183 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g18183
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g18183
>Glyma15g18183.1   sequence type=CDS   gene model=Glyma15g18183   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGGATTCTTCTTTTCTCCTTTTTATATTGCTACTAAATCGTTTTGACGTTGGAATGGGATATGGGATATGTGCCCAATACATTTTCTCCTTATATTCGTGTACACATTGTTTTTCTTGTTTCTTTACTCTTGTGATTGATGACAAAGACAACATTCTTTCAAACCTGCAGATCTTTAATGAATTTAATGCTCGAAAGCCAGATGAATTCAACATATTCAAAGGAGTCACAAGAAACTACCTCTTTATGGGTATCATTGGATTAACGGTTGTGCTTCAGATTGTCATCATTGAATTTCTTGGCAAGTTTACATCAACAGTGAGGCTTAATTGGAAGCATTGGCTCATCTCTGTCGTTATTGGATTGATTGGTTGGCCTCTTGCTGTGATTGGGAAATTGATACCGGTGCCAACAACTCCCATCAACAACGTTTTTTCAAAATTTCGAATTTCTAGAAAGAAGGAACCTGAGGAATCTCAATAG
Predicted protein sequences of Glyma15g18183
>Glyma15g18183.1   sequence type=predicted peptide   gene model=Glyma15g18183   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMDSSFLLFILLLNRFDVGMGYGICAQYIFSLYSCTHCFSCFFTLVIDDKDNILSNLQIFNEFNARKPDEFNIFKGVTRNYLFMGIIGLTVVLQIVIIEFLGKFTSTVRLNWKHWLISVVIGLIGWPLAVIGKLIPVPTTPINNVFSKFRISRKKEPEESQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo