SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g17090

Feature Type:gene_model
Chromosome:Gm15
Start:13402839
stop:13403237
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g17090
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23230AT Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr3:8289647-8290066 REVERSE LENGTH=139 SoyBaseE_val: 2.00E-40ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_B9HU98UniRef Annotation by Michelle Graham. Most informative UniRef hit: AP2/ERF domain-containing transcription factor n=1 Tax=Populus trichocarpa RepID=B9HU98_POPTR SoyBaseE_val: 1.00E-39ISS
UniRef100_I1MGW5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGW5_SOYBN SoyBaseE_val: 8.00E-92ISS

Expression Patterns of Glyma15g17090
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g17090
ParalogEvidenceComments
Glyma09g05840 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g17090 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g159100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g17090
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g17090
>Glyma15g17090.1   sequence type=CDS   gene model=Glyma15g17090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGGCACATAAGGGGGAGCAAGACAAAGAGAAAGGAGGGGAAGAAGTGAAGTACCGTGGCGTGAGAAGGAGGCCATGGGGTAAGTTCGGAGCAGAGATCAGAGACCCAACAAAATCTACAGGAAGACAATGGTTAGGGACATTTGACACGGCGGAAGAAGCAGCTAGAGCTTATGATCGTGCAGCCATTGAATTGAGGGGTGCTCTTGCAATCCTTAATTTTCCTGATGAGTACTATGCTCATCTCCCTTTTGTATCATCAAACCCTTCTATTTCAAGTAATGGAAGTTCCTATGCTGCACAACAGAAGGAGGTTATTGAGTTTGAGTGTTTGGATAACAAGGTGTTGGAAGACCTTCTTGAGTCCGAAGTGAAAAGAAGGAACGAGGACTAA
Predicted protein sequences of Glyma15g17090
>Glyma15g17090.1   sequence type=predicted peptide   gene model=Glyma15g17090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEAHKGEQDKEKGGEEVKYRGVRRRPWGKFGAEIRDPTKSTGRQWLGTFDTAEEAARAYDRAAIELRGALAILNFPDEYYAHLPFVSSNPSISSNGSSYAAQQKEVIEFECLDNKVLEDLLESEVKRRNED*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo