Glyma15g17051 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g17051

Feature Type:	gene_model
Chromosome:	Gm15
Start:	13348456
stop:	13349031
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g17051

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G41980	AT	Annotation by Michelle Graham. TAIR10: CONTAINS InterPro DOMAIN/s: Putative harbinger transposase-derived nuclease (InterPro:IPR006912); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G43722.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). \| chr5:16793765-16794889 FORWARD LENGTH=374	SoyBase	E_val: 3.00E-18	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016788	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds	SoyBase	N/A	ISS
UniRef100_UPI000233F24D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F24D related cluster n=1 Tax=unknown RepID=UPI000233F24D	SoyBase	E_val: 3.00E-104	ISS

Expression Patterns of Glyma15g17051

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g17051 not represented in the dataset	Glyma15g17051 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g17051 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g17051

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g17051

Limit To All Plant Sequences

>Glyma15g17051.1   sequence type=CDS   gene model=Glyma15g17051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAGTAGTATAGTTGATGCTTCGACTGCTTCAAGAAAACGTAAAAGAGATGAAAAAGAGGAAGAAGAACTTGAACAAGCATTTTTCATTATTGTTAGTGTTGCCACTATGCCTTTGAGTGCACTGACTTGGTATCATGACAAGTACTTTGTTAAGGAACCTGCCCAAAATTTGGAATTAGAAAGACATAGTTTCCTCAATCGTCTATATAGGAGAACAAAAACTGATTGCATTGAACAATTAAGGGTCAATAAAAAGGCATTTTTTAACCTTTGTAGAATTTTACAAGAGAAAGGGAAATTGGTAAAAACAAGGAATGTTCCTATAGCTGAAGTTGTGGCAATGTTTTTGCATATCCTTGCTCACAACCTAAAGTATAGAGTTGTGCACTTTAGTTATTGTAGATCCATGGAAACAATAAGTAGGCAATTCAAGAATTTCCTACGAGCTATAATGAAAGTAAGAAAAGAATATTTGAAGTTCCATGACTATAAACTAGAGGGCTCGGTGGAAAACAAATGGAGATGGTTTAAGGTAGGTTTGTCATTTGTTAGTAATTATAAGGTACTTTAA

Predicted protein sequences of Glyma15g17051

Limit To All Plant Sequences

>Glyma15g17051.1   sequence type=predicted peptide   gene model=Glyma15g17051   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESSIVDASTASRKRKRDEKEEEELEQAFFIIVSVATMPLSALTWYHDKYFVKEPAQNLELERHSFLNRLYRRTKTDCIEQLRVNKKAFFNLCRILQEKGKLVKTRNVPIAEVVAMFLHILAHNLKYRVVHFSYCRSMETISRQFKNFLRAIMKVRKEYLKFHDYKLEGSVENKWRWFKVGLSFVSNYKVL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain