SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g16560

Feature Type:gene_model
Chromosome:Gm15
Start:12864223
stop:12866245
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g16560
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G20260AT Annotation by Michelle Graham. TAIR10: plasma-membrane associated cation-binding protein 1 | chr4:10941593-10943227 FORWARD LENGTH=225 SoyBaseE_val: 2.00E-52ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0006816GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion transport SoyBaseN/AISS
GO:0006970GO-bp Annotation by Michelle Graham. GO Biological Process: response to osmotic stress SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010350GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to magnesium starvation SoyBaseN/AISS
GO:0018008GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal peptidyl-glycine N-myristoylation SoyBaseN/AISS
GO:0031115GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of microtubule polymerization SoyBaseN/AISS
GO:0031117GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of microtubule depolymerization SoyBaseN/AISS
GO:0035865GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to potassium ion SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043622GO-bp Annotation by Michelle Graham. GO Biological Process: cortical microtubule organization SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0051511GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051592GO-bp Annotation by Michelle Graham. GO Biological Process: response to calcium ion SoyBaseN/AISS
GO:0071219GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to molecule of bacterial origin SoyBaseN/AISS
GO:0071280GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to copper ion SoyBaseN/AISS
GO:0071281GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion SoyBaseN/AISS
GO:0071286GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to magnesium ion SoyBaseN/AISS
GO:0071325GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to mannitol stimulus SoyBaseN/AISS
GO:0071472GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to salt stress SoyBaseN/AISS
GO:0072709GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to sorbitol SoyBaseN/AISS
GO:0075733GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular transport of viral material SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005881GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasmic microtubule SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0046658GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to plasma membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005546GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-4,5-bisphosphate binding SoyBaseN/AISS
GO:0005547GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,4,5-trisphosphate binding SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
GO:0043325GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,4-bisphosphate binding SoyBaseN/AISS
GO:0080025GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylinositol-3,5-bisphosphate binding SoyBaseN/AISS
PTHR22683Panther SPORULATION PROTEIN RELATED JGI ISS
PTHR22683:SF34Panther SUBFAMILY NOT NAMED JGI ISS
PF05558PFAM DREPP plasma membrane polypeptide JGI ISS
UniRef100_I1MGS2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGS2_SOYBN SoyBaseE_val: 6.00E-140ISS
UniRef100_Q9SMK5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plasma membrane intrinsic polypeptide n=1 Tax=Cicer arietinum RepID=Q9SMK5_CICAR SoyBaseE_val: 2.00E-62ISS

Expression Patterns of Glyma15g16560
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g16560
ParalogEvidenceComments
Glyma09g05230 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g16560 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g154700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g16560
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g16560
>Glyma15g16560.1   sequence type=CDS   gene model=Glyma15g16560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTATTGGAAGTCTAAGGTTCTTCCCAAGATCAAGAAGGTTTTTGAGAAGAATAGCACCAAGAAAGCTGCTGCTGCTGAGGCCACCAAGTCCTTTGATGAGTCAAAGGAGGAATACAACAAAGCCTTTGAAGAAAAGAAGACTGAACTTCAAACTAAAGTAGTTGAAATATACGAGGCTTCATCAACTGAAATCAAAAGTTTGGTTAAAGAACCCAAGGAAGCTGGTTTGAAGAAGAACTCCACAGAAGTCCAGAAGTTCCTAGAAGAGCTTGTTAAAATTGATTTTCCGGGATCAAAGGCAGCATCTGAAGCATCTTCAAAGTTTGGACCAGCCTTGGCTTCAGGCTCAGTTTTCTTTGTGTTTGAGAAGGTGTCAACTTTCATTGTTACAGAAGAGAAAGATGTTGAAGCCCCTCCTGGAGTAGAAACTAAAACAGAAGAAGAAACAAGTAGTGTTGTCAAAGAGAGGGAGATAGTGGTTGAAGAAGAGAAAAAGAAAGAAAAAAAGGAAGAGGAAAAACCACAAGTAATAGAGACAAGTGATGAGAAAAAGGTGGAAGAAAAACCAGCTGAGACTTCTGCAAAAGGGGAAGAGAAACCTGCTGAAGAAGCTGCTGCAGTAGTTGAGCAAGCAGAACCACCAAAGCCTTGA
Predicted protein sequences of Glyma15g16560
>Glyma15g16560.1   sequence type=predicted peptide   gene model=Glyma15g16560   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGYWKSKVLPKIKKVFEKNSTKKAAAAEATKSFDESKEEYNKAFEEKKTELQTKVVEIYEASSTEIKSLVKEPKEAGLKKNSTEVQKFLEELVKIDFPGSKAASEASSKFGPALASGSVFFVFEKVSTFIVTEEKDVEAPPGVETKTEEETSSVVKEREIVVEEEKKKEKKEEEKPQVIETSDEKKVEEKPAETSAKGEEKPAEEAAAVVEQAEPPKP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo