Glyma15g16460 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g16460

Feature Type:	gene_model
Chromosome:	Gm15
Start:	12750898
stop:	12752991
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g16460

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47810	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit B5 \| chr2:19582938-19583420 REVERSE LENGTH=160	SoyBase	E_val: 1.00E-48	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG0869	KOG	CCAAT-binding factor, subunit A (HAP3)	JGI		ISS
PTHR11064	Panther	TATA-BINDING PROTEIN-ASSOCIATED PHOSPHOPROTEIN	JGI		ISS
PTHR11064:SF9	Panther	CCAAT-BINDING TRANSCRIPTION FACTOR SUBUNIT A	JGI		ISS
PF00808	PFAM	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	JGI		ISS
UniRef100_I1MGR2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MGR2_SOYBN	SoyBase	E_val: 4.00E-68	ISS
UniRef100_I3TAX6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit B18 n=1 Tax=Medicago truncatula RepID=I3TAX6_MEDTR	SoyBase	E_val: 7.00E-58	ISS

Expression Patterns of Glyma15g16460

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g16460

Paralog	Evidence	Comments
Glyma09g05150	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g16460 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g153900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g16460

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g16460

Limit To All Plant Sequences

>Glyma15g16460.2   sequence type=CDS   gene model=Glyma15g16460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGATATTGGAGGCAGTTCCTCAAACGACAACAACAACAATGGTGGCATCATCAAGGAACAGGACCGGTTGCTGCCAATAGCCAATGTTGGTCGGCTCATGAAGCGGATTCTTCCTCAGAACGCCAAAATCTCGAAGGAGGCGAAGGAGACGATGCAGGAATGTGTGTCGGAGTTCATAAGCTTCGTGACGAGTGAGGCTTCGGAGAAGTGCAGGAAGGAGAGGAGGAAGACAGTGAATGGTGATGACATTTGTTGGGCCTTGGCAACACTAGGCTTTGATAACTATGCTGAACCAATGAGAAGGAAATCAAGGACGAAAATCCAGGAAGCATCAACCAACCAAAATGATTTGTATGTTGAAAAATGGCAACCTATGAAGAGCATAAAATAA

Predicted protein sequences of Glyma15g16460

Limit To All Plant Sequences

>Glyma15g16460.2   sequence type=predicted peptide   gene model=Glyma15g16460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEDIGGSSSNDNNNNGGIIKEQDRLLPIANVGRLMKRILPQNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALATLGFDNYAEPMRRKSRTKIQEASTNQNDLYVEKWQPMKSIK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain