SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g16441

Feature Type:gene_model
Chromosome:Gm15
Start:12731085
stop:12731588
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g16441
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G30700AT Annotation by Michelle Graham. TAIR10: FAD-binding Berberine family protein | chr1:10892623-10894437 FORWARD LENGTH=527 SoyBaseE_val: 1.00E-46ISS
GO:0006865GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid transport SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0008762GO-mf Annotation by Michelle Graham. GO Molecular Function: UDP-N-acetylmuramate dehydrogenase activity SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016614GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on CH-OH group of donors SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
PTHR11748Panther D-LACTATE DEHYDROGENASE JGI ISS
PTHR11748:SF29Panther SUBFAMILY NOT NAMED JGI ISS
PF08031PFAM Berberine and berberine like JGI ISS
UniRef100_B9SAZ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Reticuline oxidase, putative n=1 Tax=Ricinus communis RepID=B9SAZ2_RICCO SoyBaseE_val: 7.00E-50ISS
UniRef100_I1MG76UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MG76_SOYBN SoyBaseE_val: 5.00E-96ISS

Expression Patterns of Glyma15g16441
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g16441 not represented in the dataset
Glyma15g16441 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g16441 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g16441
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g16441
>Glyma15g16441.1   sequence type=CDS   gene model=Glyma15g16441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGAATTAGAGAAAGCAGTAATGTATTTCAACCCTTATGGTGGAAGAATGGCTGAGAATCCATCAACAGAAACTGCTTTCCCTCATAGAGCCGGGAACCTGTGGATGATCCAATACAAAGCAGATAGGTATGAGACAGGACAAGAGGTAGCAAAATACTACATAAACTTGGTAAGAGATCTTCATAAGTACATGACTCCTTTTGTCTCTCAGAACCTAAGACAAGCTTTCATGTGTTACAAGGACTTGGATTTGGGCATCAACCACCACAATGTTTATGGCTACTTTGAAGGGAGTTCTTATGGAGTTCAGTACTTCCATGATAACTTCAAAAGGTTGGTTCAAATAAAGACCAGGGTTGATCCTGCCAATTTCTTTAGGACTGAACAAAGCATCCCGGTACTTAGCCATGCGGAATTAGTTAGAATGGTTACTGAAAAATCGATAGTTCCTATTTTGTTCGGGTTGTTCGCATTAAATTGGATTCGAACCTTCAAATAA
Predicted protein sequences of Glyma15g16441
>Glyma15g16441.1   sequence type=predicted peptide   gene model=Glyma15g16441   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIELEKAVMYFNPYGGRMAENPSTETAFPHRAGNLWMIQYKADRYETGQEVAKYYINLVRDLHKYMTPFVSQNLRQAFMCYKDLDLGINHHNVYGYFEGSSYGVQYFHDNFKRLVQIKTRVDPANFFRTEQSIPVLSHAELVRMVTEKSIVPILFGLFALNWIRTFK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo