SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g16360

Feature Type:gene_model
Chromosome:Gm15
Start:12659002
stop:12660720
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g16360
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G09070AT Annotation by Michelle Graham. TAIR10: soybean gene regulated by cold-2 | chr1:2927767-2928741 FORWARD LENGTH=324 SoyBaseE_val: 2.00E-48ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006820GO-bp Annotation by Michelle Graham. GO Biological Process: anion transport SoyBaseN/AISS
GO:0006862GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide transport SoyBaseN/AISS
GO:0006888GO-bp Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015696GO-bp Annotation by Michelle Graham. GO Biological Process: ammonium transport SoyBaseN/AISS
GO:0015802GO-bp Annotation by Michelle Graham. GO Biological Process: basic amino acid transport SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043090GO-bp Annotation by Michelle Graham. GO Biological Process: amino acid import SoyBaseN/AISS
GO:0043269GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of ion transport SoyBaseN/AISS
GO:0000326GO-cc Annotation by Michelle Graham. GO Cellular Compartment: protein storage vacuole SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00168PFAM C2 domain JGI ISS
UniRef100_I1MGQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGQ0_SOYBN SoyBaseE_val: 0ISS
UniRef100_O04133UniRef Annotation by Michelle Graham. Most informative UniRef hit: SRC2 n=1 Tax=Glycine max RepID=O04133_SOYBN SoyBaseE_val: 1.00E-172ISS

Expression Patterns of Glyma15g16360
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g16360
ParalogEvidenceComments
Glyma09g05100 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g16360 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g152900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g16360
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g16360
>Glyma15g16360.1   sequence type=CDS   gene model=Glyma15g16360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCATGGAATACAGAACCTTAGAACTCAACATCATATCCGCAAAGGACATCAAGAATGTTAATCTCTTCTCCAAGATGGACGTATACGCCGCCGTTTCGCTCTCCGGTGACCCTCTCCACCCTCAGGGCGCCACCACCCACGTCCACAAAGACGCCGGCAGCAACCCCACGTGGAACTACCCCGTGAAATTCTCTGTCAACGAATCGCTGGCGAAGGAAAATCGTTTATCTCTTGAGATCAAGCTCATCTCCGACCGCACCCTCGGCGACACCGTCATCGGCACCGTCCATGTTCCTCTCAGGGAACTCCTGGATAACCCCGGCGATGACAGCTCCTTCCGCCAAGTCAGTTATCAGGTGATGAAGCAATCAAGAAAATCCAAGGGATCCTTGAATTTCTCCTACAAATTCGGCGAACATGTTCCCGCCCCGGCCGCCAAGACACCCAAAGCGGCCAAGGCGGGACAAGAGCCGGTGATGGCTTATCCTCCTGCTGGGGCGGGATCCAGTTCGATGCCCTATGGTACGCCACACCCTCCCCCGCCGCAGCAATATGCGGCGACGGGATATGGGTATCCACCTCAGCAGGTGCATGGTGGATACCCACCTCAAGCAGCATATGGGTACCCACCTCAGACCGGTTATGGATACCCACAACAGTCGGGTTATGGATATCCACAACAATCCGGATATGGGTACCCACCTCAGGCTCAGAAACCAAAGAAGAACAAATTTGGAATGGGATTGGGAGCAGGATTGCTTGGTGGTGCCTTGGGTGGAATGTTGATCGGAGACATGGTATCTGATGCTGCTGAATATGATGCGGGCTTTGATGATGCTGGTGGATTTGATTTTTAA
Predicted protein sequences of Glyma15g16360
>Glyma15g16360.1   sequence type=predicted peptide   gene model=Glyma15g16360   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTMEYRTLELNIISAKDIKNVNLFSKMDVYAAVSLSGDPLHPQGATTHVHKDAGSNPTWNYPVKFSVNESLAKENRLSLEIKLISDRTLGDTVIGTVHVPLRELLDNPGDDSSFRQVSYQVMKQSRKSKGSLNFSYKFGEHVPAPAAKTPKAAKAGQEPVMAYPPAGAGSSSMPYGTPHPPPPQQYAATGYGYPPQQVHGGYPPQAAYGYPPQTGYGYPQQSGYGYPQQSGYGYPPQAQKPKKNKFGMGLGAGLLGGALGGMLIGDMVSDAAEYDAGFDDAGGFDF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo