SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g15990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g15990): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g15990

Feature Type:gene_model
Chromosome:Gm15
Start:12330085
stop:12331272
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g15990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15910AT Annotation by Michelle Graham. TAIR10: drought-induced 21 | chr4:9028657-9029269 FORWARD LENGTH=104 SoyBaseE_val: 2.00E-14ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03242PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_O24422UniRef Annotation by Michelle Graham. Most informative UniRef hit: Desiccation protective protein LEA5 n=1 Tax=Glycine max RepID=O24422_SOYBN SoyBaseE_val: 3.00E-23ISS
UniRef100_UPI000189D67AUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D67A related cluster n=1 Tax=unknown RepID=UPI000189D67A SoyBaseE_val: 4.00E-65ISS

Expression Patterns of Glyma15g15990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g15990 not represented in the dataset
Glyma15g15990 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g15990
ParalogEvidenceComments
Glyma09g04870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g15990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g149600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g15990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g15990
>Glyma15g15990.1   sequence type=CDS   gene model=Glyma15g15990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCACAATCTTTCTCACCAGCCAAACGCGCCCTTGCCTTTTCCCTTCACCGGCGAGGGTACGCAGTGGCGTCTGATGCTTCTCCTTCGGTGAGAGGGGGATTGGATAGCATTGGAAGCAGGAGTGCAATCGAGAAGGGTGTGACAAAAAACAATTCGGGCCCATCGGGGGCCTCATCAGCTTGGGCCCCGGACCCAGTGACGGGTTACTACAGGCCCATCAATCACACCAATGAGATTGACCCGGTGGAGCTTCGAAGGATGCTGTTGAAACACAAAGTCAGATCATCATCCTCCTCCTAG
Predicted protein sequences of Glyma15g15990
>Glyma15g15990.1   sequence type=predicted peptide   gene model=Glyma15g15990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQSFSPAKRALAFSLHRRGYAVASDASPSVRGGLDSIGSRSAIEKGVTKNNSGPSGASSAWAPDPVTGYYRPINHTNEIDPVELRRMLLKHKVRSSSSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo