Glyma15g15810 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g15810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g15810): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g15810

Feature Type:	gene_model
Chromosome:	Gm15
Start:	12153757
stop:	12154260
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g15810

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G47770	AT	Annotation by Michelle Graham. TAIR10: TSPO(outer membrane tryptophan-rich sensory protein)-related \| chr2:19568701-19569291 FORWARD LENGTH=196	SoyBase	E_val: 5.00E-34	ISS
GO:0006778	GO-bp	Annotation by Michelle Graham. GO Biological Process: porphyrin-containing compound metabolic process	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005795	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi stack	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
KOG3797	KOG	Peripheral-type benzodiazepine receptor and related proteins	JGI		ISS
PTHR10057	Panther	PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR	JGI		ISS
PTHR10057:SF0	Panther	PERIPHERAL-TYPE BENZODIAZEPINE RECEPTOR	JGI		ISS
PF03073	PFAM	TspO/MBR family	JGI		ISS
UniRef100_B9T0W2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Peripheral-type benzodiazepine receptor, putative n=1 Tax=Ricinus communis RepID=B9T0W2_RICCO	SoyBase	E_val: 9.00E-49	ISS
UniRef100_I1MGL3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGL3_SOYBN	SoyBase	E_val: 1.00E-116	ISS

Expression Patterns of Glyma15g15810

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g15810 not represented in the dataset	Glyma15g15810 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g15810

Paralog	Evidence	Comments
Glyma09g05020	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g15810 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g147800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g15810

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g15810

Limit To All Plant Sequences

>Glyma15g15810.1   sequence type=CDS   gene model=Glyma15g15810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCAAATCTTGCATGACACAAAGAAATCCCAAGCTAGGCGAGCATTACGTTCTCTAGCAATAGGCATTGCAGTTCCCTTCACTCTCACATTGGCCATAATCATCATCTTTGGTTCCGGACGCAAGTATAACCAAATTATATCCAAACCATTTTGGTTTTCACCACTTTGGTTCATTCACTTGGCCACATTGGGTTCATCTTTCTTCATGGGTCTCGCGATGTGGCTAGTATGGGCTGATGGAGGATTTCAAGGAGAAACTGATGCAATGTCTCTCTACATAGTCCATGTCTCTCTAAGTATCGTGTGGCATCCTCTTGTGCTTGTTATGGGTGTTTATTGGCTTGCTTTAATTTCTTGCCTTGTGAATTTTGGAACCCTCTTTTTATGCTACTTGAGGTTTAGAAAGGTGAATCCTTTTGCCAGAGATCTAGCCAAACCATGCTTGACATGGACTGCGTACCTTTGTCTGGTTAGCTTTAAGCTAATGTTTATTTGA

Predicted protein sequences of Glyma15g15810

Limit To All Plant Sequences

>Glyma15g15810.1   sequence type=predicted peptide   gene model=Glyma15g15810   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASQILHDTKKSQARRALRSLAIGIAVPFTLTLAIIIIFGSGRKYNQIISKPFWFSPLWFIHLATLGSSFFMGLAMWLVWADGGFQGETDAMSLYIVHVSLSIVWHPLVLVMGVYWLALISCLVNFGTLFLCYLRFRKVNPFARDLAKPCLTWTAYLCLVSFKLMFI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain