Glyma15g15671 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g15671): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g15671): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g15671

Feature Type:	gene_model
Chromosome:	Gm15
Start:	12031088
stop:	12032846
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g15671

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G24020	AT	Annotation by Michelle Graham. TAIR10: MLP-like protein 423 \| chr1:8500653-8501458 REVERSE LENGTH=155	SoyBase	E_val: 5.00E-11	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PF00407	PFAM	Pathogenesis-related protein Bet v I family	JGI		ISS
UniRef100_B9RTB8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Major allergen Pru ar, putative n=1 Tax=Ricinus communis RepID=B9RTB8_RICCO	SoyBase	E_val: 4.00E-59	ISS
UniRef100_UPI000233BE5C	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BE5C related cluster n=1 Tax=unknown RepID=UPI000233BE5C	SoyBase	E_val: 2.00E-109	ISS

Expression Patterns of Glyma15g15671

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g15671 not represented in the dataset	Glyma15g15671 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g15671

Paralog	Evidence	Comments
Glyma09g04555	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g15671 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g146500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g15671

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g15671

Limit To All Plant Sequences

>Glyma15g15671.1   sequence type=CDS   gene model=Glyma15g15671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTTTACTCTGACACAGATGAGTACCCCTCTCCAATCTCTCCATCAAGGTTGTTCAAGGCCTTGGTTGTTGATGCTCACAACCTCATTCCAAAACTTCTGCCAAATTCTGTGAAGAGCATTGAAATCATACAAGGGGATGGGGGGGCAGGAAGCATCAAGCAGTTTAACTTTGTTGAAGGCAACCAAGTAAAAAATATCAAGAACCGGATTGATGAGATAGACGAGGAGACACTTACTTACAATTACACACTGATTGAAGGGGAAGCCTTGAAGGATAAGTTTGCATCCATTGCTCATGAGATTAAGTTTGAAGCAGCACCTGATGGTGGTAGCATAAGTAAGGTAACAAGCAAGTATTATCTTAAAGGTGATGTTGAGATCAATGAAGAGGACATTAAGGCTAGCAAGGAGATTGTCTTGGGCATTTACAAAGTTGTGGAAGCCTATCTCCTGCAGAACCCTGATGTGTATGCTTGA

Predicted protein sequences of Glyma15g15671

Limit To All Plant Sequences

>Glyma15g15671.1   sequence type=predicted peptide   gene model=Glyma15g15671   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVYSDTDEYPSPISPSRLFKALVVDAHNLIPKLLPNSVKSIEIIQGDGGAGSIKQFNFVEGNQVKNIKNRIDEIDEETLTYNYTLIEGEALKDKFASIAHEIKFEAAPDGGSISKVTSKYYLKGDVEINEEDIKASKEIVLGIYKVVEAYLLQNPDVYA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain