SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g15530

Feature Type:gene_model
Chromosome:Gm15
Start:11947073
stop:11948329
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g15530
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATMG00160AT Annotation by Michelle Graham. TAIR10: cytochrome oxidase 2 | chrM:40502-42628 REVERSE LENGTH=260 SoyBaseE_val: 2.00E-22ISS
GO:0022900GO-bp Annotation by Michelle Graham. GO Biological Process: electron transport chain SoyBaseN/AISS
GO:0022904GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory electron transport chain SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005751GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex IV SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004129GO-mf Annotation by Michelle Graham. GO Molecular Function: cytochrome-c oxidase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0020037GO-mf Annotation by Michelle Graham. GO Molecular Function: heme binding SoyBaseN/AISS
PTHR22888Panther CYTOCHROME C OXIDASE, SUBUNIT II JGI ISS
PF00116PFAM Cytochrome C oxidase subunit II, periplasmic domain JGI ISS
PF02790PFAM Cytochrome C oxidase subunit II, transmembrane domain JGI ISS
UniRef100_I1MGJ0UniRef Annotation by Michelle Graham. Best UniRef hit: Cytochrome c oxidase subunit 2 n=1 Tax=Glycine max RepID=I1MGJ0_SOYBN SoyBaseE_val: 3.00E-122ISS
UniRef100_I1MGJ0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome c oxidase subunit 2 n=1 Tax=Glycine max RepID=I1MGJ0_SOYBN SoyBaseE_val: 3.00E-122ISS

Expression Patterns of Glyma15g15530
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g15530
ParalogEvidenceComments
Glyma09g04480 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g15530 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g15530
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g15530
>Glyma15g15530.1   sequence type=CDS   gene model=Glyma15g15530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATTAGGATTTCAAGATGCAGCAACACCTATAGTGCAAGGAATAATAGACTTACATCACGATATCATTTTCTTCGTCATTCAGATTGCAGTTTTTGTAGTATGGATCTTGCAGCTCGTGCTTTATGGCATTTCAGGTCTAAAATAAATCCAATCCCGCAAAGGATTGTTCATGGAACAACAATCGAGATTCTGTGGACCGTATTTCCTAGTGTCATACTGATGTTCATTGCTATACCGTCATTTGCTTTGTTATATTCAATGGACGACGTTGTATTGATGTACGTAATTCATAGTTGGGCAGTACCTTCCTTAGGTGTCAAATGTGATGCTGTACATGGTCGTTTAAATAAGACGAGAAGGGGTTTAATTATTATGGTCAATGCAGTGAGATTTGTGGAACTAATCATGCCTTTATGCCTATTAGACCTTCAAACTGAATCATGGATGTGCACCATGGGCTTGAACGGCTTTTGCCGGAGCTTATTTTGCCAAGGCTTATTTTCTTCA
Predicted protein sequences of Glyma15g15530
>Glyma15g15530.1   sequence type=predicted peptide   gene model=Glyma15g15530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIRISRCSNTYSARNNRLTSRYHFLRHSDCSFCSMDLAARALWHFRSKINPIPQRIVHGTTIEILWTVFPSVILMFIAIPSFALLYSMDDVVLMYVIHSWAVPSLGVKCDAVHGRLNKTRRGLIIMVNAVRFVELIMPLCLLDLQTESWMCTMGLNGFCRSLFCQGLFSS






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo