| 
 | 
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code | 
|---|---|---|---|---|---|
| AT2G01050 | AT | Annotation by Michelle Graham. TAIR10: zinc ion binding;nucleic acid binding | chr2:68337-69884 REVERSE LENGTH=515 | SoyBase | E_val: 2.00E-13 | ISS | 
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS | 
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS | 
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS | 
| GO:0008270 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: zinc ion binding | SoyBase | N/A | ISS | 
| PF00098 | PFAM | Zinc knuckle | JGI | ISS | |
| UniRef100_I1MGI1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGI1_SOYBN | SoyBase | E_val: 9.00E-42 | ISS | 
| UniRef100_Q1SKZ9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger, CCHC-type n=1 Tax=Medicago truncatula RepID=Q1SKZ9_MEDTR | SoyBase | E_val: 1.00E-12 | ISS | 
| Glyma15g15431 not represented in the dataset | Glyma15g15431 not represented in the dataset | 
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection | Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome | 
| Corresponding Name | Annotation Version | Evidence | Comments | 
|---|---|---|---|
| Glyma.15g144300 | Wm82.a2.v1 | IGC | As supplied by JGI | 
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 | 
>Glyma15g15431.1 sequence type=CDS gene model=Glyma15g15431 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTAAGATCCACTTTGGGTGTTATGTTGAAAATCGATAAGGTTACTACAATACAAGCTAGAGGCGAATTCACCAAAATCTGTGTGGAGCTAGATTTGGATAAACCTTTAAAACCAAAGGTTATTGCAAGGGGATATTTGTTGAACCTGCAATGTGAGGGGCTACATGTGATATGCTTCAATTGTGGTAGATATGGCCACATAATACAAAAATGTCCCAGGGTAGATTTCGAATGA
>Glyma15g15431.1 sequence type=predicted peptide gene model=Glyma15g15431 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LRSTLGVMLKIDKVTTIQARGEFTKICVELDLDKPLKPKVIARGYLLNLQCEGLHVICFNCGRYGHIIQKCPRVDFE*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||