SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g15211

Feature Type:gene_model
Chromosome:Gm15
Start:11635058
stop:11636618
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G16260AT Annotation by Michelle Graham. TAIR10: Glycosyl hydrolase superfamily protein | chr4:9200180-9201441 REVERSE LENGTH=344 SoyBaseE_val: 3.00E-80ISS
GO:0002215GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to nematode SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009817GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus, incompatible interaction SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0043169GO-mf Annotation by Michelle Graham. GO Molecular Function: cation binding SoyBaseN/AISS
PTHR16631Panther GLUCAN 1,3-BETA-GLUCOSIDASE-RELATED JGI ISS
PF00332PFAM Glycosyl hydrolases family 17 JGI ISS
UniRef100_I7GGY8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Beta-1,3-glucanase n=1 Tax=Sesbania rostrata RepID=I7GGY8_SESRO SoyBaseE_val: 1.00E-122ISS
UniRef100_UPI000233B044UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B044 related cluster n=1 Tax=unknown RepID=UPI000233B044 SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g15211 not represented in the dataset

Glyma15g15211 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g04200 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g142500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g15211.1   sequence type=CDS   gene model=Glyma15g15211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCTCTTCGCCAGAACCAAGTGGTTCTCGTTGCCTACTCTCCTGCTTCTTCTGGAGCTATTCACAATAAACCTTAGCACTGCAGATGCTCAAATTGGGGTGTGTTATGGCATGATTGGCGACAATCTACCACCGGCAAACGAAGTTGTACCTGCTTTACAAGCACTTAGAAATTCGGGCATTGAGCTTACTCTTGGGGTGCTCCAGCAAGACCTTCAAGGCCTTGCCACCAATGCCTCCATTGCTCAACAATGGGTGCAAAGTAACGTGTTGAACTTTTGGCCTAGTGTCAAAATCAAGTACGTGGTAGTTGGCAATGAAATTGATCCTGTTGGAAGTTCTTCTCAGTTTGCCCAATATGTTCTACCTGCAATCCAAAACACATACCAAGCTATAAGGGCTCAAGGCCTTCATGATCTAATCAAGGTTACAACAGCTATTAGCATGGACCTATTAGGAAACTCCTATACCCCATCACAAAACTACTTCAAGCCTGATGTGAGGTCATACATAGACCCCATAATTGGGTACTTGGTATATGCAAATGCACCTTTACTAGCCAATGTGTTACCTTATTTTAGTTACGCTAATAACTCTATTGACATATCAGTTTCCTATGCTCTTTTCAACAAATGTTGTGATGGAGGGTTTGCTGCCACTTATGACAACACGCGCGTCTATCTGAAAAATCTGATTCTTCATGCTAAAAGAGGTAATTCAAGAAGGCCTTCAAAGCCCACAAAGATTTATATATTTGTCATGTTCGATGAAAATCTAAAGACTCCTGAGATACAGAAACATTTTGGACTACTTTTTCCTAACAAAACAAAGAAGTATCCATTTGGATTTAATTAG

>Glyma15g15211.1   sequence type=predicted peptide   gene model=Glyma15g15211   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLFARTKWFSLPTLLLLLELFTINLSTADAQIGVCYGMIGDNLPPANEVVPALQALRNSGIELTLGVLQQDLQGLATNASIAQQWVQSNVLNFWPSVKIKYVVVGNEIDPVGSSSQFAQYVLPAIQNTYQAIRAQGLHDLIKVTTAISMDLLGNSYTPSQNYFKPDVRSYIDPIIGYLVYANAPLLANVLPYFSYANNSIDISVSYALFNKCCDGGFAATYDNTRVYLKNLILHAKRGNSRRPSKPTKIYIFVMFDENLKTPEIQKHFGLLFPNKTKKYPFGFN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo