SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g15190

Feature Type:gene_model
Chromosome:Gm15
Start:11607297
stop:11609403
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g15190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G51980AT Annotation by Michelle Graham. TAIR10: Insulinase (Peptidase family M16) protein | chr1:19323929-19326771 REVERSE LENGTH=451 SoyBaseE_val: 9.00E-19ISS
GO:0006007GO-bp Annotation by Michelle Graham. GO Biological Process: glucose catabolic process SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0009060GO-bp Annotation by Michelle Graham. GO Biological Process: aerobic respiration SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005750GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex III SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004222GO-mf Annotation by Michelle Graham. GO Molecular Function: metalloendopeptidase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR11851Panther METALLOPROTEASE JGI ISS
PTHR11851:SF69Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7L7C9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial-processing peptidase subunit alpha n=1 Tax=Medicago truncatula RepID=G7L7C9_MEDTR SoyBaseE_val: 2.00E-26ISS
UniRef100_UPI000233BB50UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BB50 related cluster n=1 Tax=unknown RepID=UPI000233BB50 SoyBaseE_val: 2.00E-92ISS

Expression Patterns of Glyma15g15190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g15190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g15190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g15190
>Glyma15g15190.1   sequence type=CDS   gene model=Glyma15g15190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACAGTAACAACCTCTTCTCCGATTACTTTTCCGACGACCTCGATTCCTCCCCTACCGTCCCCACTGTCGTGACCACGACCACGACCACCACTGCGACCTGGTGGCTCGAAGAAGCTGATCATCGAGGAGAGGCCGTGCTTTATACGGCCCGTTCATGCAGCAGCAGCAGGATACCTGCCAGTGCCAAATTTGCAAGTTCCGTTGCCACACAACAATCCTCTTCTGGTTTGGGTGGTTTATTTGGATGGCTCGCTGGAGACCGATCCAATTCTTTACCATCTCTAGATTTCCGGCTTCTGGGCGTTATACTTCCCCCTTCATTGCCTAATTTTGTTGCGCCCGGAAAAACTATTATTACTACACTCCCAAATGGACTCAAAGTGGCCTCTGAAACATCACCGGTTAACGAGCAGCTTCTGAAAGTGAAGGCTGAGATTGGTGAAGCTTCCAAAAATCCCCAAGACTTGCTTTTGGAAGCAATTCATTCTGCTGGTTTTTCTGGTGCCTTGGCAAATCCTCTTTTAGCTTCAGAATCAGCTCTAAATAGACTAAATGGTACAATTCTGGAGGAGTTTGTTACTTGTATATGTTGGCAATCACTTGCTTTGAAAGATCCTGCTAGGTATATGTTCACTTGCAACACCTTTTCTCACTCCCTTTCAAATACTTCCAAGAGCTTGGGAATTATCATAGTTTCATTCAATGATCAGAGGCAAATTATTTGCAGGATGATTCTTGCTCAGATGACTCTGCCAGTTTATAGTATAAATTATTTTACGTTATCAGCAATGTATTCCAATTCCAAATGTATTGAACAAATTAAATTCGAGGATATTAATATTCTAAATACATATTTAGGCATATATGAC
Predicted protein sequences of Glyma15g15190
>Glyma15g15190.1   sequence type=predicted peptide   gene model=Glyma15g15190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSNNLFSDYFSDDLDSSPTVPTVVTTTTTTTATWWLEEADHRGEAVLYTARSCSSSRIPASAKFASSVATQQSSSGLGGLFGWLAGDRSNSLPSLDFRLLGVILPPSLPNFVAPGKTIITTLPNGLKVASETSPVNEQLLKVKAEIGEASKNPQDLLLEAIHSAGFSGALANPLLASESALNRLNGTILEEFVTCICWQSLALKDPARYMFTCNTFSHSLSNTSKSLGIIIVSFNDQRQIICRMILAQMTLPVYSINYFTLSAMYSNSKCIEQIKFEDINILNTYLGIYD






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo