SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g15080

Feature Type:gene_model
Chromosome:Gm15
Start:11526350
stop:11528359
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17020AT Annotation by Michelle Graham. TAIR10: Adenine nucleotide alpha hydrolases-like superfamily protein | chr3:5802728-5804063 REVERSE LENGTH=163 SoyBaseE_val: 7.00E-76ISS
GO:0002238GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of fungal origin SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00582PFAM Universal stress protein family JGI ISS
UniRef100_G7IFX8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Universal stress protein A-like protein n=1 Tax=Medicago truncatula RepID=G7IFX8_MEDTR SoyBaseE_val: 2.00E-76ISS
UniRef100_I1MGF3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGF3_SOYBN SoyBaseE_val: 3.00E-117ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g141000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g15080.1   sequence type=CDS   gene model=Glyma15g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGGTGCAAGAAGATTGGGCGTGGCTGTTGATTTCTCAGCATGCAGCATCAAAGCACTGAATTGGACGGTGGATAACGTCGTCAGAGAAGGAGACAACCTCATCCTCATCATCGTTCGCAATGCTCATGGTTACGAGCACGGTGAGATGCAGCTCTGGGAAACCACTGGCTCACCTCTGATACCTCTGGCTGAGTTCTCTGACCCTGTGCTCATGAAGAGATATGAACTGAAACCAGCACCTGAAGTAATTGATATTGTGTCAACTGCTGCCAAGCAAAAGAATATTGTGGTGCTAATGAAGATCTATTGGGGAGATGCTCGTGAGAGGTTATGCGAAGCAATTGATCATGTACCTTTAGACTACCTTACCTTAGGGAACAGAGGCCTTGGCACGCTCCAAAGGGTTATAATGGGTAGCGTCAGCAACTATGTAGTGAATAATGCCACCTGTCCTGTCACTGTGGTGAAGAGTTCAGTCCACAACTATTAG

>Glyma15g15080.1   sequence type=predicted peptide   gene model=Glyma15g15080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGARRLGVAVDFSACSIKALNWTVDNVVREGDNLILIIVRNAHGYEHGEMQLWETTGSPLIPLAEFSDPVLMKRYELKPAPEVIDIVSTAAKQKNIVVLMKIYWGDARERLCEAIDHVPLDYLTLGNRGLGTLQRVIMGSVSNYVVNNATCPVTVVKSSVHNY*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo