Glyma15g15043 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g15043

Feature Type:	gene_model
Chromosome:	Gm15
Start:	11499439
stop:	11501648
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g15043

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18260	AT	Annotation by Michelle Graham. TAIR10: HCP-like superfamily protein \| chr1:6279047-6282008 REVERSE LENGTH=678	SoyBase	E_val: 5.00E-13	ISS
GO:0006888	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport	SoyBase	N/A	ISS
GO:0030433	GO-bp	Annotation by Michelle Graham. GO Biological Process: ER-associated protein catabolic process	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
UniRef100_Q4R1J3	UniRef	Annotation by Michelle Graham. Best UniRef hit: SEL-1 n=1 Tax=Glycine max RepID=Q4R1J3_SOYBN	SoyBase	E_val: 8.00E-23	ISS
UniRef100_Q4R1J3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SEL-1 n=1 Tax=Glycine max RepID=Q4R1J3_SOYBN	SoyBase	E_val: 8.00E-23	ISS

Expression Patterns of Glyma15g15043

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g15043 not represented in the dataset	Glyma15g15043 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g15043 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g140700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g15043

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g15043

Limit To All Plant Sequences

>Glyma15g15043.1   sequence type=CDS   gene model=Glyma15g15043   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACACACTCTCTCTCTTAGTGGAGACGTGAGGATTGTTGACCTTTACACTGATACGCAGAACATAGCCGAGAGTGGGCACCCGGCGGTGCAATTGGTGCTAGGGTTTTTGTGGGAAATGGGGCTTTTTAGAGAGCAAATCAAGGGGAAGGCCTTTCGGTACCACCACTTCACCGCAGAGGGAGGCAACATGCAATCGAAGATGGAATTGGTCTACAACTACACGAGGAGCGACCACTCCTGTCCTCCAGCCACGTCACGCGCCCCCCCAGCTACGGCTTTGTCCGCATGA

Predicted protein sequences of Glyma15g15043

Limit To All Plant Sequences

>Glyma15g15043.1   sequence type=predicted peptide   gene model=Glyma15g15043   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSHTLSLSGDVRIVDLYTDTQNIAESGHPAVQLVLGFLWEMGLFREQIKGKAFRYHHFTAEGGNMQSKMELVYNYTRSDHSCPPATSRAPPATALSA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain