SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g14893

Feature Type:gene_model
Chromosome:Gm15
Start:11346630
stop:11350407
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g14893
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G06600AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 15 plant structures; EXPRESSED DURING: 7 growth stages; Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr3:2059558-2060458 REVERSE LENGTH=193 SoyBaseE_val: 1.00E-10ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1L0Q1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L0Q1_SOYBN SoyBaseE_val: 2.00E-96ISS

Expression Patterns of Glyma15g14893
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g14893 not represented in the dataset
Glyma15g14893 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g14893
ParalogEvidenceComments
Glyma09g03930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g14893 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g139300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g14893
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g14893
>Glyma15g14893.1   sequence type=CDS   gene model=Glyma15g14893   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAGAACACCAAACATCACACAAAGTGTTCGCGCGCTCCACAGAGAATCGCCATGGCAGATTCAAGGATTTTCCGTCTAAGAAGTCTAACAAGATCACAGATAAGAGCTTGAATGCGGCATTTGCATCCCTTTCTGAAGATTCCGTGGATTTATCACCGATCTCCGAGATCTCATTTGCAAATCACAACGAAGATGTCACGAACTTCTTGTTGGAAGAACCTTCCTCGGTGACTTTGGTTCCATCTGATTTAAGTCCTAAAAAAATCACCGACGCAACGGAAATTATTGGGTCCGCTAATTCTATTTGCAACGATGAATTAGATAGTTCTAGGTTTAATTCTGTGGAAGCTGAGATTACTGTGAATTTTCTCAGAAATGTTAAAGCTCCCCAATTTAGAAGAGAGCTTATGGATGGCATAATTGAGTATGTTATAAGTGATCTCCAAACCTATACCTTGCCAGAGGAGAGAGATCAGTTTGCTCATTTGCTTTCGATGAAAAGTCGAATGTTGTTTCTGTGTACCTTCATTTGGGTAATTGGAGTATCAGTTCTGCTTTTCTTCACTTTGGATGCTCGTGGCCCTTACAGAGGACCGACGCCAACCTGA
Predicted protein sequences of Glyma15g14893
>Glyma15g14893.1   sequence type=predicted peptide   gene model=Glyma15g14893   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKEHQTSHKVFARSTENRHGRFKDFPSKKSNKITDKSLNAAFASLSEDSVDLSPISEISFANHNEDVTNFLLEEPSSVTLVPSDLSPKKITDATEIIGSANSICNDELDSSRFNSVEAEITVNFLRNVKAPQFRRELMDGIIEYVISDLQTYTLPEERDQFAHLLSMKSRMLFLCTFIWVIGVSVLLFFTLDARGPYRGPTPT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo