SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g14870

Feature Type:gene_model
Chromosome:Gm15
Start:11311159
stop:11317470
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g14870
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49510AT Annotation by Michelle Graham. TAIR10: prefoldin 3 | chr5:20080729-20082456 FORWARD LENGTH=195 SoyBaseE_val: 9.00E-107ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016272GO-cc Annotation by Michelle Graham. GO Cellular Compartment: prefoldin complex SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
KOG3313 KOG Molecular chaperone Prefoldin, subunit 3 JGI ISS
PTHR12409Panther PREFOLDIN SUBUNIT 3-RELATED JGI ISS
PF02996PFAM Prefoldin subunit JGI ISS
UniRef100_C6T5K5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T5K5_SOYBN SoyBaseE_val: 1.00E-137ISS
UniRef100_G7IMS6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prefoldin subunit n=1 Tax=Medicago truncatula RepID=G7IMS6_MEDTR SoyBaseE_val: 1.00E-111ISS

Expression Patterns of Glyma15g14870
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g14870
ParalogEvidenceComments
Glyma09g03910 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g14870 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g139100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g14870
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g14870
>Glyma15g14870.1   sequence type=CDS   gene model=Glyma15g14870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTTCGTCTTCAGCGTCGGGTTCGGGTTCAGCTTCGGCGGTGACGGAGCGAAGAGGAATACCAGGGGCTCAGTTCGTGGAGGATGTCCAAACTTACCTTACTCAATCGGGTCTCGATGTTGGTTCAGCCCTCGCTTTTCTCCAAGAAAGACTTCAGCAATACAAGGTAGTAGAAATGAAGCTTCTTGCTCAGCAAAGAGATCTTCAGGCAAAGATACCAGATATTGAAAAGTGCCTAGATGTTGTTGCTACATTGAAAGCTAAGAAGGGTACTGGTGAGGAACTTATTGCTGATTTTGAAGTATCAGAAGGCATCTATTCACAAGCACGTATAGAAGAAACTGATTCCGTGTGTTTATGGCTGGGAGCAAATGTTATGCTGGAATATTCTTTAGAAGAGGCTACTGGTCTTCTACAGAAGAACCTGGACAATGCTAGAGCCAGTTTGGAAGTTCTTATTGCTGATCTACAATTCTTGAGGGACCAAGTGACAATTACTCAGGTTACAATTGCTCGTGTGTATAATTGGGATGTTCATCAACGGAGAATTCAACAAGCTGTTGCTACAACTGCTCAAGACTAG
Predicted protein sequences of Glyma15g14870
>Glyma15g14870.1   sequence type=predicted peptide   gene model=Glyma15g14870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSSSASGSGSASAVTERRGIPGAQFVEDVQTYLTQSGLDVGSALAFLQERLQQYKVVEMKLLAQQRDLQAKIPDIEKCLDVVATLKAKKGTGEELIADFEVSEGIYSQARIEETDSVCLWLGANVMLEYSLEEATGLLQKNLDNARASLEVLIADLQFLRDQVTITQVTIARVYNWDVHQRRIQQAVATTAQD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo