Glyma15g14825 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g14825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g14825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g14825

Feature Type:	gene_model
Chromosome:	Gm15
Start:	11272691
stop:	11273767
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g14825

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32285	AT	Annotation by Michelle Graham. TAIR10: ENTH/ANTH/VHS superfamily protein \| chr4:15586003-15587910 FORWARD LENGTH=635	SoyBase	E_val: 2.00E-33	ISS
GO:0048268	GO-bp	Annotation by Michelle Graham. GO Biological Process: clathrin coat assembly	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0030118	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: clathrin coat	SoyBase	N/A	ISS
GO:0005543	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipid binding	SoyBase	N/A	ISS
GO:0005545	GO-mf	Annotation by Michelle Graham. GO Molecular Function: 1-phosphatidylinositol binding	SoyBase	N/A	ISS
GO:0030276	GO-mf	Annotation by Michelle Graham. GO Molecular Function: clathrin binding	SoyBase	N/A	ISS
PTHR22951	Panther	CLATHRIN ASSEMBLY PROTEIN	JGI		ISS
PTHR22951:SF1	Panther	CLATHRIN ASSEMBLY PROTEIN	JGI		ISS
PF07651	PFAM	ANTH domain	JGI		ISS
UniRef100_G7JE64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Epsin N-terminal homology (ENTH) domain-containing protein n=1 Tax=Medicago truncatula RepID=G7JE64_MEDTR	SoyBase	E_val: 7.00E-57	ISS
UniRef100_I1LZP6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LZP6_SOYBN	SoyBase	E_val: 6.00E-87	ISS

Expression Patterns of Glyma15g14825

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g14825 not represented in the dataset	Glyma15g14825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g14825 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g14825

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g14825

Limit To All Plant Sequences

>Glyma15g14825.1   sequence type=CDS   gene model=Glyma15g14825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAAGGACGAGATCATGCACTCCACGTGCCTCGGCACCTTGAGGATTCTCAACATGTCTGACTTCAGAGATGACGCGCATTCCAACTCATCGGATCAAGTGGGTTTCGTTAGGGTTTACTCGTTGTATCTCGATGCGAAGGTTGATTTTGTGGCTTATAGGAGAAAATTAAGCGGCAGAGTTGTTGAATCTGTGGAGTTTAGGGATGAGTTTGGTTCTGCTGAGAGAGAGGGGAATGAGGTTACTCCTGTGAGGGAAATGGGAGCTGAGAGAGTTTTGAAGAGGTTGAACCATTTGCTGTGGATGCTTGATCGTGTCTTGGGTTGTAGGCCCAATGGTGCTGCCAAGAACAATAGCTTGGTGCTGGTTGCACTTTACCAGGTTGTGGATGTGAGGGATAGTTTTAAGCTTTATGTAGAGGTGTGTGATGTTTTAGGGGTGTTGTTGGATCGGTTTTCACCGAGATGGAGTATGAGCATTATGTTGTTGGATCGGTGTGTGAAGGCCTTTTTCAATTCAGTCTAA

Predicted protein sequences of Glyma15g14825

Limit To All Plant Sequences

>Glyma15g14825.1   sequence type=predicted peptide   gene model=Glyma15g14825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKDEIMHSTCLGTLRILNMSDFRDDAHSNSSDQVGFVRVYSLYLDAKVDFVAYRRKLSGRVVESVEFRDEFGSAEREGNEVTPVREMGAERVLKRLNHLLWMLDRVLGCRPNGAAKNNSLVLVALYQVVDVRDSFKLYVEVCDVLGVLLDRFSPRWSMSIMLLDRCVKAFFNSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain