SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g14760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g14760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g14760

Feature Type:gene_model
Chromosome:Gm15
Start:11235667
stop:11239462
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g14760
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49540AT Annotation by Michelle Graham. TAIR10: Rab5-interacting family protein | chr5:20104804-20105609 REVERSE LENGTH=114 SoyBaseE_val: 6.00E-51ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG4455 KOG Uncharacterized conserved protein JGI ISS
PTHR20994Panther UNCHARACTERIZED JGI ISS
PF07019PFAM Rab5-interacting protein (Rab5ip) JGI ISS
UniRef100_C6T2Y4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2Y4_SOYBN SoyBaseE_val: 1.00E-79ISS
UniRef100_G7IUB5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transmembrane protein n=1 Tax=Medicago truncatula RepID=G7IUB5_MEDTR SoyBaseE_val: 2.00E-64ISS

Expression Patterns of Glyma15g14760
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g14760 not represented in the dataset
Glyma15g14760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g14760
ParalogEvidenceComments
Glyma09g03832 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g14760 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g138200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g14760
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g14760
>Glyma15g14760.1   sequence type=CDS   gene model=Glyma15g14760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTACATTCCGAATCAGCTTCATCAGAGAAGAAATCAAGCAATGGAGTGAATGAGTTGCTGACTTTTAATGCTGAGAATATGCAAAGCAACATGAAAATTATCTATTACAGCCGAACATTTTTATCTATAATTGGTGGCGTTGTTGCTGGAATTTTGGGATTTACAGGCTTGAAAGGATTTGTGTTTTATTTACTTCTCATGGCACTTACTTCACTTGGGCTTGTGGCCAAAGCAAAATTTTCAACCCACACATACTTTGACTCCTGGAATCGAGTGCTACTTGATGGCTTTCAGGGTGGCCTAATGTCGTTCGTGCTGTTCTGGACATTTGCCTATGACATTGTTCATATATTTTGA
Predicted protein sequences of Glyma15g14760
>Glyma15g14760.1   sequence type=predicted peptide   gene model=Glyma15g14760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVHSESASSEKKSSNGVNELLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTGLKGFVFYLLLMALTSLGLVAKAKFSTHTYFDSWNRVLLDGFQGGLMSFVLFWTFAYDIVHIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo