SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g14500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g14500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g14500

Feature Type:gene_model
Chromosome:Gm15
Start:10953768
stop:10955201
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40010AT Annotation by Michelle Graham. TAIR10: AAA-ATPase 1 | chr5:16020218-16021762 REVERSE LENGTH=514 SoyBaseE_val: 1.00E-33ISS
GO:0001666GO-bp Annotation by Michelle Graham. GO Biological Process: response to hypoxia SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR23070Panther BCS1 AAA-TYPE ATPASE JGI ISS
PTHR23070:SF1Panther AAA-TYPE ATPASE-RELATED JGI ISS
UniRef100_G7KK16UniRef Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial chaperone BCS1 n=1 Tax=Medicago truncatula RepID=G7KK16_MEDTR SoyBaseE_val: 9.00E-41ISS
UniRef100_I1MGA6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGA6_SOYBN SoyBaseE_val: 6.00E-167ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g14500 not represented in the dataset

Glyma15g14500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g14500.1   sequence type=CDS   gene model=Glyma15g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTATCAGATGTGGACACAGGCAGGGTCACTCATGGCCTCAACCATGTTCATATATGACATGTTCATGCGCTTGTACACCAACAAATTCACCAGCTTTGTGTACCCTTACATCAGAATCACGTTCCACGAATTCACCGGTGAACGCCTCATGAAAAGTGAGGCTTACAATGCCATCCAAACCTACCTTACTGAAGCAATAAAGGGGAAAAACACACGCACCCCGTTGATGCTTAGCATGAACGATAACAAAAAAATCATAGAAGAGTTCCAAGGAGTGAAGGTGTGGTGGTCCTTTCCTTGGAACTCTTCTTCGGATGAAAAAAGGTACTACAAACTTACCTTTCAAAAGCGCTATAGAAGCCTCATAACCGAGTCTTACCTCAAACATAATAGACAACTGAAGCTTTACACCAACAGCAAGACAAGGTGGAGCCATGTGGATAAACGCTACATAAACGCGATTAAATACGTGCTACATAAACGCTGGCTGTTCTTTAATTTTGAAAAAAAAGTCTACATGTACAAAATGTCATCATTTGAAAAAGGAATTGGTTTGGTTTGGGCAATCATCAAATATGCAATTATCAAAGGAAGGATCTGCCAATTAGTCAATGTCCATATTGTTGGCATTGCCAAAATAATGTGCTTCCTGACTTCCTCTAAAAGAATAAAACTACTTTCA

>Glyma15g14500.1   sequence type=predicted peptide   gene model=Glyma15g14500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYQMWTQAGSLMASTMFIYDMFMRLYTNKFTSFVYPYIRITFHEFTGERLMKSEAYNAIQTYLTEAIKGKNTRTPLMLSMNDNKKIIEEFQGVKVWWSFPWNSSSDEKRYYKLTFQKRYRSLITESYLKHNRQLKLYTNSKTRWSHVDKRYINAIKYVLHKRWLFFNFEKKVYMYKMSSFEKGIGLVWAIIKYAIIKGRICQLVNVHIVGIAKIMCFLTSSKRIKLLS







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo