SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g14111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g14111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g14111

Feature Type:gene_model
Chromosome:Gm15
Start:10639365
stop:10641359
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G69730AT Annotation by Michelle Graham. TAIR10: Wall-associated kinase family protein | chr1:26228703-26231339 REVERSE LENGTH=792 SoyBaseE_val: 6.00E-45ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF444Panther SUBFAMILY NOT NAMED JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_A0F0B1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cold-induced wall associated kinase (Fragment) n=1 Tax=Ammopiptanthus mongolicus RepID=A0F0B1_9FABA SoyBaseE_val: 7.00E-63ISS
UniRef100_UPI000233801DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233801D related cluster n=1 Tax=unknown RepID=UPI000233801D SoyBaseE_val: 5.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g14111 not represented in the dataset

Glyma15g14111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g03160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g14111.1   sequence type=CDS   gene model=Glyma15g14111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGTTTGGGGACAGAAATACCCTTGCTTGTTATGAATTCATTCCTAATGGTAACCTTTTTCAATATTTACATGATCAAAACGAGGACTTACCAATGACATGGGATATTCGTTTGAGAATTGCAACAGGAATTGCAGGAGCACTGTTTTACTTGCACTCAGTTGCATCTCAACCCATTTATCACAGAGACATCAAATCCACAAATATTCTATTGGATGAAAAGTATAGAGCTAAAATTGCAGACTTTGGAGCAACCCGAATGATTTCCATTGAAGATACTCATCTCACCACAGTCGTTCAAGGCCAACAACCAATGTCCTCAGTGAGAAATGCGGAATCCAATAATTTGGCTTCATATTTTGTTCAGTGTATGGAGGAGGATAATCTGTTTGACATTATTGACAAAAAGAGTTGTGAAAGAAGCAGAGAAGGGGCAAATCATTGCAGTTGCTAA

>Glyma15g14111.1   sequence type=predicted peptide   gene model=Glyma15g14111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLFGDRNTLACYEFIPNGNLFQYLHDQNEDLPMTWDIRLRIATGIAGALFYLHSVASQPIYHRDIKSTNILLDEKYRAKIADFGATRMISIEDTHLTTVVQGQQPMSSVRNAESNNLASYFVQCMEEDNLFDIIDKKSCERSREGANHCSC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo