SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g13141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g13141): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g13141

Feature Type:gene_model
Chromosome:Gm15
Start:9791197
stop:9791733
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G59880AT Annotation by Michelle Graham. TAIR10: actin depolymerizing factor 3 | chr5:24120382-24121628 FORWARD LENGTH=139 SoyBaseE_val: 1.00E-85ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006979GO-bp Annotation by Michelle Graham. GO Biological Process: response to oxidative stress SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003779GO-mf Annotation by Michelle Graham. GO Molecular Function: actin binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG1735 KOG Actin depolymerizing factor JGI ISS
PTHR11913Panther ACTIN DEPOLYMERIZING FACTOR JGI ISS
PF00241PFAM Cofilin/tropomyosin-type actin-binding protein JGI ISS
UniRef100_Q2PK12UniRef Annotation by Michelle Graham. Most informative UniRef hit: Actin depolymerizing factor-like protein n=1 Tax=Arachis hypogaea RepID=Q2PK12_ARAHY SoyBaseE_val: 3.00E-94ISS
UniRef100_UPI000233D4CAUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D4CA related cluster n=1 Tax=unknown RepID=UPI000233D4CA SoyBaseE_val: 2.00E-98ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g13141 not represented in the dataset

Glyma15g13141 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g02241 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g125300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g13141.1   sequence type=CDS   gene model=Glyma15g13141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAAACGCAGCATCTGGTATGGCAGTCCATGATGACTGCAAGTTGAGGTTTTTGGAGCTGAAGGCAAAAAGGACACACCGTTTCATAGTTTTTAAGATTGAGGAGCAGCAGAAGCAGGTCATTGTGGAGAAGCTTGGTGAGCCTGCCCAGGGCTATGAAGATTTCACTGCCAGCCTTCCTGCTGACGAGTGCCGTTATGCTGTTTATGATTTTGAGTATCTGACTGAAGGGAATGTCCCTAAAAGCAGAATTTTTTTCATTGCGTGGTCCCCTGACACATCAAGGGTGAGGAGCAAGATGATTTATGCAAGCTCCAAAGACAGATTCAAGAGGGAGCTGGATGGAATTCAAGTAGAGTTGCAAGCAACTGATCCTACTGAGATGGGTCTTGATGTGTTCAAAAGCCGTGCCAACTAA

>Glyma15g13141.1   sequence type=predicted peptide   gene model=Glyma15g13141   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANAASGMAVHDDCKLRFLELKAKRTHRFIVFKIEEQQKQVIVEKLGEPAQGYEDFTASLPADECRYAVYDFEYLTEGNVPKSRIFFIAWSPDTSRVRSKMIYASSKDRFKRELDGIQVELQATDPTEMGLDVFKSRAN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo