SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g12121): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g12121): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g12121

Feature Type:gene_model
Chromosome:Gm15
Start:8978711
stop:8979022
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g12121
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G12064AT Annotation by Michelle Graham. TAIR10: unknown protein; LOCATED IN: endomembrane system; Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). | chr1:4077705-4078034 REVERSE LENGTH=109 SoyBaseE_val: 1.00E-16ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
UniRef100_I1MFN2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MFN2_SOYBN SoyBaseE_val: 5.00E-41ISS
UniRef100_Q2HT38UniRef Annotation by Michelle Graham. Most informative UniRef hit: TNFR/CD27/30/40/95 cysteine-rich region n=1 Tax=Medicago truncatula RepID=Q2HT38_MEDTR SoyBaseE_val: 2.00E-37ISS

Expression Patterns of Glyma15g12121
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g12121 not represented in the dataset
Glyma15g12121 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g12121 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g114500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g12121
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g12121
>Glyma15g12121.1   sequence type=CDS   gene model=Glyma15g12121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACGAAGAAGCGCATAGTATCATTCCAATTACAAGCACAGGCGCTGTTGCTGGTTATGATGATGGTGGCTTCACCTATCATGAGTTGTCCACCCACAGATGGAAGGGGATGCAAAGACTGCATTGTGAACCAGATGAAAAACGCTTGTCCTCCCTGCACACCAATCCTACACTGCATGGCTCGGTGCTTGTGGGATGGCAGCTCAAGGCCCAATTGCATCAAGAAATGCGACTGCAACACCACCTACCCCACCCTCTCTGACTGCAAGGGATGCATGTCCAAGTGCAAGTGCAGCTGCGTCAACTAG
Predicted protein sequences of Glyma15g12121
>Glyma15g12121.1   sequence type=predicted peptide   gene model=Glyma15g12121   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METKKRIVSFQLQAQALLLVMMMVASPIMSCPPTDGRGCKDCIVNQMKNACPPCTPILHCMARCLWDGSSRPNCIKKCDCNTTYPTLSDCKGCMSKCKCSCVN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo