SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G22310 | AT | Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0041) | chr4:11791443-11792638 FORWARD LENGTH=108 | SoyBase | E_val: 6.00E-59 | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009060 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aerobic respiration | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
| KOG1589 | KOG | Uncharacterized conserved protein | JGI | ISS | |
| PTHR14154 | Panther | UPF0041 BRAIN PROTEIN 44-RELATED | JGI | ISS | |
| PTHR14154:SF2 | Panther | gb def: putative protein [arabidopsis thaliana] | JGI | ISS | |
| PF03650 | PFAM | Uncharacterised protein family (UPF0041) | JGI | ISS | |
| UniRef100_B9RXD3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Brain protein, putative n=1 Tax=Ricinus communis RepID=B9RXD3_RICCO | SoyBase | E_val: 1.00E-57 | ISS |
| UniRef100_I1KZY1 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KZY1_SOYBN | SoyBase | E_val: 8.00E-62 | ISS |
|
Glyma15g12040 not represented in the dataset |
Glyma15g12040 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma09g01210 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g113800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g12040.1 sequence type=CDS gene model=Glyma15g12040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCGGCTGCAAAGCTTCAAGCTTTATGGAATCACCCAGCTGGGCCTAAAACCATTCACTTCTGGGCACCTACCTTTAAGTGGGGCATCAGCATTGCCAACATTGCTGATTTCTCAAAACCACCTGAGAAACTTTCCTATCCTCAGCAAATAGCGGTCACAGCTACTGGAATTATCTGGTCTCGTTACAGCACTGTAATCACCCCAAAAAATTGGAACCTGTTTAGTGTAAACATTGCAATGGCAGGGACAGGCATATACCAACTATCACGCAAATTGCGGTAA
>Glyma15g12040.1 sequence type=predicted peptide gene model=Glyma15g12040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAAAKLQALWNHPAGPKTIHFWAPTFKWGISIANIADFSKPPEKLSYPQQIAVTATGIIWSRYSTVITPKNWNLFSVNIAMAGTGIYQLSRKLR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
