Report for Sequence Feature Glyma15g11840
Feature Type: gene_model
Chromosome: Gm15
Start: 8719444
stop: 8724546
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g11840
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G14620 AT
Annotation by Michelle Graham. TAIR10: decoy | chr1:5014948-5016501 REVERSE LENGTH=233
SoyBase E_val: 2.00E-120 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0009909 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of flower development
SoyBase N/A ISS
GO:0034968 GO-bp
Annotation by Michelle Graham. GO Biological Process: histone lysine methylation
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG4548
KOG
Mitochondrial ribosomal protein L17
JGI ISS
PTHR13124 Panther
39S RIBOSOMAL PROTEIN L46, MITOCHONDRIAL PRECURSOR-RELATED
JGI ISS
PTHR13124:SF2 Panther
gb def: cg13922 gene product [drosophila melanogaster]
JGI ISS
PF11788 PFAM
39S mitochondrial ribosomal protein L46
JGI ISS
UniRef100_G7L791 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 39S ribosomal protein L46 n=1 Tax=Medicago truncatula RepID=G7L791_MEDTR
SoyBase E_val: 1.00E-150 ISS
UniRef100_I1MFK8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFK8_SOYBN
SoyBase E_val: 2.00E-170 ISS
Expression Patterns of Glyma15g11840
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma15g11840
Paralog Evidence Comments
Glyma09g00990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g11840 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g111800 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g11840
Coding sequences of Glyma15g11840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g11840.1 sequence type=CDS gene model=Glyma15g11840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGATGTCACTGGTTCAACTTCGACCTCTCTTGACAAGGCGAGGGTTCAGCGCAAGCTCTGAGAACCTTGTTGCTTCTGTGCTCTTTGAGAGACTGCCAGTGGTCATTCCCAAAATTGACCCTGTAGTTTATGCATTTCAAGAATTCTCGTTTCGATGGCGACAACAATATCAACGCAGATATCCTGATGAATTTCTAGACAAATCTGATGCTAGGGGTAAAGGTGATTATCAGATTGACTATGTGCCAGCACCAAGAGTCACTGAAGCTGACAAAAACAATGATCGAAGGTCATTACAAAGAGCTCTTGATAGAAGACTCTACCTTCTCCTCTATGGTAATGCATATGGTGCTCCAAGCGGGAAGCCTGTGTGGCATTTTCCTGAGAAAGTTTATGAATCTGAGGACACCATGCGCAAGTGTGCAGAATCTGCATTGAAATCAGTCTTAGGAGATCTTTCTAACACATATTTTGTTGGAAATGCTCCAATGGCCCATATGGTTGTTCAGCCTACAGAAGACCAGTCTAGATCCACATCTTTTAAGAGATTCTTCTTCAAGTCTCAAGTTATTGCCAAAAACAAATTCAACATCGGAAAATGTGAGGATCATGTCTGGGTGACAAAGGATGAACTGATGGAGTATTTTCCCGAGCAAGCTGAGTTTTTAAACAAGATGATCATTAGCTGA
Predicted protein sequences of Glyma15g11840
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g11840.1 sequence type=predicted peptide gene model=Glyma15g11840 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKMSLVQLRPLLTRRGFSASSENLVASVLFERLPVVIPKIDPVVYAFQEFSFRWRQQYQRRYPDEFLDKSDARGKGDYQIDYVPAPRVTEADKNNDRRSLQRALDRRLYLLLYGNAYGAPSGKPVWHFPEKVYESEDTMRKCAESALKSVLGDLSNTYFVGNAPMAHMVVQPTEDQSRSTSFKRFFFKSQVIAKNKFNIGKCEDHVWVTKDELMEYFPEQAEFLNKMIIS*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
