SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g11590

Feature Type:gene_model
Chromosome:Gm15
Start:8543164
stop:8546993
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g11590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11860AT Annotation by Michelle Graham. TAIR10: Glycine cleavage T-protein family | chr1:4001801-4003245 FORWARD LENGTH=408 SoyBaseE_val: 0ISS
GO:0006546GO-bp Annotation by Michelle Graham. GO Biological Process: glycine catabolic process SoyBaseN/AISS
GO:0007389GO-bp Annotation by Michelle Graham. GO Biological Process: pattern specification process SoyBaseN/AISS
GO:0008361GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell size SoyBaseN/AISS
GO:0009658GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast organization SoyBaseN/AISS
GO:0009926GO-bp Annotation by Michelle Graham. GO Biological Process: auxin polar transport SoyBaseN/AISS
GO:0010015GO-bp Annotation by Michelle Graham. GO Biological Process: root morphogenesis SoyBaseN/AISS
GO:0010075GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0022626GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004047GO-mf Annotation by Michelle Graham. GO Molecular Function: aminomethyltransferase activity SoyBaseN/AISS
KOG2770 KOG Aminomethyl transferase JGI ISS
PTHR13847Panther FAD NAD BINDING OXIDOREDUCTASES JGI ISS
PTHR13847:SF5Panther gb def: n,n-dimethylglycine oxidase [arthrobacter globiformis] JGI ISS
PF01571PFAM Aminomethyltransferase folate-binding domain JGI ISS
PF08669PFAM Glycine cleavage T-protein C-terminal barrel domain JGI ISS
UniRef100_I1MFI3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Aminomethyltransferase n=1 Tax=Glycine max RepID=I1MFI3_SOYBN SoyBaseE_val: 0ISS
UniRef100_I1MFI3UniRef Annotation by Michelle Graham. Best UniRef hit: Aminomethyltransferase n=1 Tax=Glycine max RepID=I1MFI3_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma15g11590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g11590
ParalogEvidenceComments
Glyma09g00711 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g11590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g109300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g11590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g11590
>Glyma15g11590.1   sequence type=CDS   gene model=Glyma15g11590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGTGGGGCTTGTGGAAACTTGGGCAATCAATCCCTCGCCGTCTTGCTCACGGTAATAATAAAGCTGTTGCTTGTCGATATTTTGCCTCAGATGCTGAGCTGAAAAAGACAGTCCTTTATGACTTCCATGTTGCTAATGGAGGGAAGATGGTGCCATTTGCTGGATGGAGCATGCCAATCCAATACAAGGACTCAATTATGGACTCAACCCTTAACTGTAGGGAGAATGGTAGCCTTTTTGATGTTTCCCATATGTGCGGGCTAAGCCTCAAGGGAAAGGACTCTGTCCCATTCCTTGAAAAGCTTGTCATTGCAGATGTTGCTGGGCTTGCCCCTGGAACTGGTTCGTTGACTGTCTTCACAAATGAAAAAGGAGGGGCAATTGATGATTCAGTGATTACCAAGGTGAAGGATGATCACATATACTTGGTTGTGAATGCTGGATGTAGGGACAAAGATCTGGCTCATATTGAGGAACATATGAAGGCATTCAAGGCAAAAGGTGGTGATGTGTCATGGCACATCCATGATGAGAGATCTCTTCTTGCTTTGCAGGGTCCTCTTGCTGCTCCAGTTCTTCAACACCTGACAAAAGAGGATTTAAGCAAGATGTACTTTGGGGAGTTCCGTGTGTTGGACATCAATGGTGTGCAGTGCTTTCTCACACGAACAGGGTATACTGGGGAAGATGGATTTGAGATATCAATTCCCTCAGAGAGTGCAGTGGATCTTGCCAAGGCAATTCTGGAAAAATCTGAAGGGAAGATAAGACTGACAGGATTAGGTGCTCGAGATAGTCTACGACTTGAAGCTGGATTGTGTTTATATGGCAATGACTTGGAACAGCACATTACACCTATTGAGGCAGGACTCACATGGGCCATAGGGAAGAGAAGGAGAGCTGAAGGGGGTTTTCTAGGGGCTGATGTTATACTAAAACAGCTTGAAGAAGGTCCTAAGATCAGGCGTGTTGGTTTCTTTTCTTCTGGCCCTCCTCCCAGAAGCCACAGTGAGATTCAAGATGAAGGAGGAAACAACATTGGGGAAGTTTCAAGTGGCGGATTCAGTCCTTGCCTCAAGAAGAACATAGCCATTGGATATGTGAAATCAGGATTGCACAAGGCAGGCACCAAAGTAAAGATTATTATTCGAGGAAAGTCTAATGAAGGAGTTGTTACAAAGATGCCATTTGTACCAACAAAATACTATAAGCCATCCTAA
Predicted protein sequences of Glyma15g11590
>Glyma15g11590.1   sequence type=predicted peptide   gene model=Glyma15g11590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRWGLWKLGQSIPRRLAHGNNKAVACRYFASDAELKKTVLYDFHVANGGKMVPFAGWSMPIQYKDSIMDSTLNCRENGSLFDVSHMCGLSLKGKDSVPFLEKLVIADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDERSLLALQGPLAAPVLQHLTKEDLSKMYFGEFRVLDINGVQCFLTRTGYTGEDGFEISIPSESAVDLAKAILEKSEGKIRLTGLGARDSLRLEAGLCLYGNDLEQHITPIEAGLTWAIGKRRRAEGGFLGADVILKQLEEGPKIRRVGFFSSGPPPRSHSEIQDEGGNNIGEVSSGGFSPCLKKNIAIGYVKSGLHKAGTKVKIIIRGKSNEGVVTKMPFVPTKYYKPS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo