SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g11530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g11530): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g11530

Feature Type:gene_model
Chromosome:Gm15
Start:8493348
stop:8499022
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11840AT Annotation by Michelle Graham. TAIR10: glyoxalase I homolog | chr1:3995928-3997518 FORWARD LENGTH=322 SoyBaseE_val: 2.00E-178ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004462GO-mf Annotation by Michelle Graham. GO Molecular Function: lactoylglutathione lyase activity SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
KOG2943 KOG Predicted glyoxalase JGI ISS
PTHR10374Panther LACTOYLGLUTATHIONE LYASE JGI ISS
PTHR10374:SF0Panther LACTOYLGLUTATHIONE LYASE (GLYOXALASE I) JGI ISS
PF00903PFAM Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily JGI ISS
UniRef100_D2D330UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lactoylglutathione lyase n=1 Tax=Gossypium hirsutum RepID=D2D330_GOSHI SoyBaseE_val: 0ISS
UniRef100_I1MFH9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFH9_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g11530 not represented in the dataset

Glyma15g11530 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g00660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g108400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g11530.1   sequence type=CDS   gene model=Glyma15g11530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGGCTACACAATCTAATGCTGAGTTGTTGGAGTGGCCTAAGAAAGATAAGCGCCGCTTCCTGCATGTTGTGTATCGTGTTGGTGATCTTGATCGCACCATTAAGTTTTATACTGAATGTTTTGGGATGAAGCTTTTGAGGAAAAGAGATATTCCAGAGGAGAAATATGCCAATGCTTTTCTTGGATTTGGCCCTGAACAATCCCATTTTGTTGTGGAATTAACATATAATTATGGGGTGACCTCATATGATATTGGAACTGGATTTGGACATTTTGCTATCGCAACTCCAGATGTTTACAAATTGGTTGAAGACATCCGGGCTAAGGGTGGAAATGTCACCAGGGAGCCTGGTCCAGTTAAGGGTGGGAAATCTGTTATTGCCTTCGTGAAGGATCCTGATGGTTATGCTTTTGAGCTCATTCAAAGACCTTCAACCCCTGAACCATTGTGCCAAGTAATGCTTCGCGTTGGTGATTTAGAGCGCTCAATTAAGTTTTATGAAAAGGCTTTGGGTTTGAGGGTGGTAAAGAAGACTGATAGACCTGAATACAAGTATACTATAGCTATGCTTGGGTATGCAGAGGAACATGAGACAACTGTGTTGGAGCTGACATATAACTATGGTGTCACTGAATACACCAAGGGAAATGCTTATGCACAGGTTGCTATTGGTACTGATGATGTATACAAGAGTGCTGAGGTTGTCAACATAGTCACACAAGAGCTTGGAGGGAAGATTACTCGGCAACCAGGACCAATTCCTGGCCTTAACACAAAGATCACTGCTTTCTTAGATCCTGATGGATGGAAAACTGTTTTGGTTGACAATCAAGATTTTCTGAAGGAGCTGGAGTAA

>Glyma15g11530.1   sequence type=predicted peptide   gene model=Glyma15g11530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEATQSNAELLEWPKKDKRRFLHVVYRVGDLDRTIKFYTECFGMKLLRKRDIPEEKYANAFLGFGPEQSHFVVELTYNYGVTSYDIGTGFGHFAIATPDVYKLVEDIRAKGGNVTREPGPVKGGKSVIAFVKDPDGYAFELIQRPSTPEPLCQVMLRVGDLERSIKFYEKALGLRVVKKTDRPEYKYTIAMLGYAEEHETTVLELTYNYGVTEYTKGNAYAQVAIGTDDVYKSAEVVNIVTQELGGKITRQPGPIPGLNTKITAFLDPDGWKTVLVDNQDFLKELE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo