SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g11430

Feature Type:gene_model
Chromosome:Gm15
Start:8376988
stop:8377796
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g11430
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G21920AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: N-terminal protein myristoylation; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G20340.1); Has 40 Blast hits to 40 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 40; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr4:11636084-11636473 REVERSE LENGTH=129 SoyBaseE_val: 1.00E-14ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MFH0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFH0_SOYBN SoyBaseE_val: 3.00E-87ISS

Expression Patterns of Glyma15g11430
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g11430
ParalogEvidenceComments
Glyma13g27530 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g11430 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g107300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g11430
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g11430
>Glyma15g11430.1   sequence type=CDS   gene model=Glyma15g11430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAACTGTTGTGCCAGTGCCACGGAGTCATCATCTATGGATTGGGGTGGTGATGATTGGGGTTCTTTATCATCATCTAAGAAGAGAAGGAAGAATAAGGTGTTTGATGAAGTTCATGGGGAGAGTTTGGGGAACGTGGAGAAGGAGAAGCTCTTGGGTGCGCTGAGAGCTTCTTCTGATGCCAATGGGAAGGTGAAGATAAAGATCTCAAAGAAGGAGCTGGAGAAGTTGTTGGGATCAGAGAAAGAGATTAATAATAAGCAATTAGGTGAAGGACACGCTTCGGCGGAACAAGTTCTGGCTCGCTTGATACACGCTAGAGATCATGATGATGTTCATCATAGGCCTTGGAGGCCCGTGCTTCAGAGTATACCTGAGGTTAATTAA
Predicted protein sequences of Glyma15g11430
>Glyma15g11430.1   sequence type=predicted peptide   gene model=Glyma15g11430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNCCASATESSSMDWGGDDWGSLSSSKKRRKNKVFDEVHGESLGNVEKEKLLGALRASSDANGKVKIKISKKELEKLLGSEKEINNKQLGEGHASAEQVLARLIHARDHDDVHHRPWRPVLQSIPEVN*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo