SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g11240

Feature Type:gene_model
Chromosome:Gm15
Start:8239285
stop:8240926
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g11240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19190AT Annotation by Michelle Graham. TAIR10: unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G06070.1); Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:6457349-6457918 FORWARD LENGTH=154 SoyBaseE_val: 2.00E-19ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_C6T2T0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T2T0_SOYBN SoyBaseE_val: 2.00E-81ISS

Expression Patterns of Glyma15g11240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g11240
ParalogEvidenceComments
Glyma13g27725 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g11240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g105500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g11240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g11240
>Glyma15g11240.1   sequence type=CDS   gene model=Glyma15g11240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGTTGCCATGGAACTGGAAGATGATCTATTTTTTGCTGATTTGAGCAAGGAAATTGCTCTACTAATTATGGATGAAGATGAAGATCCACTTGCTTCTTGTCCTCCTGACTCTCTTCAGGCTTTTTCTGGGGCAATTCATCCTCCTCCACAGTTTGCTTTCATCTTTGAGCATGCTTTGAGAAGAGAAAGCAAAGGGACAGGTGTATTTATCCCTCAGGCAACACAGCCAAGAAGGAAGCAGAGGAAAGGAAGGGCTAATAATTCATATGCAAAACATCAAAAGCAGTCTCAAGATACAAGAATGGTTTCTCAAGTTCCTAACAAGAATTCTTTCAAATCCAGAAATGGCTGA
Predicted protein sequences of Glyma15g11240
>Glyma15g11240.1   sequence type=predicted peptide   gene model=Glyma15g11240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVAMELEDDLFFADLSKEIALLIMDEDEDPLASCPPDSLQAFSGAIHPPPQFAFIFEHALRRESKGTGVFIPQATQPRRKQRKGRANNSYAKHQKQSQDTRMVSQVPNKNSFKSRNG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo