Report for Sequence Feature Glyma15g11004
Feature Type: gene_model
Chromosome: Gm15
Start: 8023438
stop: 8029698
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g11004
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G06180 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein L34e superfamily protein | chr3:1871705-1873554 FORWARD LENGTH=241
SoyBase E_val: 8.00E-61 ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
PTHR10759 Panther
60S RIBOSOMAL PROTEIN L34
JGI ISS
PTHR10759:SF3 Panther
STRUCTURAL CONSTITUENT OF RIBOSOME
JGI ISS
UniRef100_B9RSR8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L34, putative n=1 Tax=Ricinus communis RepID=B9RSR8_RICCO
SoyBase E_val: 4.00E-63 ISS
UniRef100_I1MFD8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFD8_SOYBN
SoyBase E_val: 6.00E-138 ISS
Expression Patterns of Glyma15g11004
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g11004
Paralog Evidence Comments
Glyma13g28020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g11004 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g103200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g11004
Coding sequences of Glyma15g11004
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g11004.1 sequence type=CDS gene model=Glyma15g11004 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCAAGAGGAGAAGGTGACATTGAGCATGAGCATGAGCATGAGCATGAGCATGAACAGAGGGATGATGGTTCACTGCAACAACAATAACAATGTCAACAACACTAATAATGTGTGCAACTGCAAGCACTCTCCCTCCGCCACCTTAGACCTTCTCATCCTCCTCCTAGTCCTCTTCTCCGGCGCGTTCCTCCTCTCCTCCTACCTCTGCTACATCTTCAACTCCCTCTCCCTCCTCCTCCCCTCGGTGCCGCTCTCCTACCTCCTCCCCTTCCTCCTCTTCTTCGCCCTCTCCCTCGCCACCGCCGACTTCTGCTGCGGCGCCCGATCCCGCCGCTGCCAGCGCCAGGGCTGCAAGGGCCTCAAGAAGGCCATGGAGTTCGATTTGCAGATTCAGCGCTTCGGCTCCTCCGTGCCTTCCTCCGCCGAAATCGATAAGCTCCCCTGGAAGGGCGGCACTGAGGCCAACCCCGATTACGACTGCCTCAGGTCCGAGCTGAGGAAGATGGCTCCCCCTAACGGCCGCGCGCTTCTTCTCTTCCGGGCCCCCTGCGGCTGCCCCGTCGCCAAACTCGAGGCCTCTGGTCCCAAAAAGGCCAAACGCCATAAGAGGACCCCACCCAGTGCGACTCTTAATGGAGGAGGAGATCATCGTTGA
Predicted protein sequences of Glyma15g11004
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g11004.1 sequence type=predicted peptide gene model=Glyma15g11004 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MQEEKVTLSMSMSMSMSMNRGMMVHCNNNNNVNNTNNVCNCKHSPSATLDLLILLLVLFSGAFLLSSYLCYIFNSLSLLLPSVPLSYLLPFLLFFALSLATADFCCGARSRRCQRQGCKGLKKAMEFDLQIQRFGSSVPSSAEIDKLPWKGGTEANPDYDCLRSELRKMAPPNGRALLLFRAPCGCPVAKLEASGPKKAKRHKRTPPSATLNGGGDHR*