Report for Sequence Feature Glyma15g10750
Feature Type: gene_model
Chromosome: Gm15
Start: 7812528
stop: 7814317
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g10750
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G21860 AT
Annotation by Michelle Graham. TAIR10: methionine sulfoxide reductase B 2 | chr4:11600238-11601507 REVERSE LENGTH=202
SoyBase E_val: 9.00E-79 ISS
GO:0006979 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to oxidative stress
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009570 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma
SoyBase N/A ISS
GO:0008113 GO-mf
Annotation by Michelle Graham. GO Molecular Function: peptide-methionine (S)-S-oxide reductase activity
SoyBase N/A ISS
GO:0033743 GO-mf
Annotation by Michelle Graham. GO Molecular Function: peptide-methionine (R)-S-oxide reductase activity
SoyBase N/A ISS
KOG0856
KOG
Predicted pilin-like transcription factor
JGI ISS
PTHR10173 Panther
METHIONINE SULFOXIDE REDUCTASE
JGI ISS
PTHR10173:SF0 Panther
PEPTIDE METHIONINE SULFOXIDE REDUCTASE
JGI ISS
PF01641 PFAM
SelR domain
JGI ISS
UniRef100_C6SVM8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SVM8_SOYBN
SoyBase E_val: 9.00E-97 ISS
UniRef100_G7IFP1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Peptide methionine sulfoxide reductase msrB n=1 Tax=Medicago truncatula RepID=G7IFP1_MEDTR
SoyBase E_val: 3.00E-85 ISS
Expression Patterns of Glyma15g10750
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma15g10750
Paralog Evidence Comments
Glyma13g28320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g10750 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g100700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g10750
Coding sequences of Glyma15g10750
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g10750.1 sequence type=CDS gene model=Glyma15g10750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCAGCACCAACGCCGATTCACAAAACTGAAGAGGAATGGAAGGTCATTCTCTCCCCCGAGCAGTTTCGGATCCTTCGCCAGAAAGGAACTGAATTGAAGGGTACAGGAGAATATAACAAGTTTTTTGAAGAAGGAATTTACAACTGTGCTGGCTGTGGGACTCCTCTTTACAAGTCTTCAACCAAGTTTGATTCTGGTTGTGGTTGGCCTGCTTTCTTTGAGGGTTTTCCCGGCGCCATCAATCGAACCCCTGACCCAGATGGGAGGAGGACTGAGATAACCTGTGCAGCCTGTGGTGGGCACTTGGGTCATGTTTTCAAAGGAGAGGGATTCAAGACCCCAACTGATGAACGCCATTGCGTCAATAGTATTTCTGTCAAATTTGTTCCGGGAAGTGCTACTTTTTCAATATGA
Predicted protein sequences of Glyma15g10750
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g10750.1 sequence type=predicted peptide gene model=Glyma15g10750 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAAPTPIHKTEEEWKVILSPEQFRILRQKGTELKGTGEYNKFFEEGIYNCAGCGTPLYKSSTKFDSGCGWPAFFEGFPGAINRTPDPDGRRTEITCAACGGHLGHVFKGEGFKTPTDERHCVNSISVKFVPGSATFSI*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
