Glyma15g10710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g10710

Feature Type:	gene_model
Chromosome:	Gm15
Start:	7778113
stop:	7779614
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g10710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G21570	AT	Annotation by Michelle Graham. TAIR10: unknown protein; Has 43 Blast hits to 43 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 43; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:7600297-7600707 REVERSE LENGTH=136	SoyBase	E_val: 7.00E-20	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1MFA2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MFA2_SOYBN	SoyBase	E_val: 6.00E-120	ISS
UniRef100_O49389	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AT4g32020/F10N7_170 n=1 Tax=Arabidopsis thaliana RepID=O49389_ARATH	SoyBase	E_val: 3.00E-07	ISS

Expression Patterns of Glyma15g10710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g10710

Paralog	Evidence	Comments
Glyma13g28360	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g10710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g100300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g10710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g10710

Limit To All Plant Sequences

>Glyma15g10710.1   sequence type=CDS   gene model=Glyma15g10710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCACGGAGGTTCTACGGCCACAAGATTGTTTCACCCACCGCATCGCTGTTCCACCGGCGGGGTTTTCCCGGAGAAGAACCTCTGGGACACACAACAACAATTACTTCAGGGGCACGCGGAAGCCGGTTACCCGACCCGAACAGAGAAAACGGGTTGTGGAGAAAAGGCCCAGCTTCGATGATTCGAGGTTTTCGAGGTTGGAGATGGAGAAGGTCACCATTCTCCGGAGGGGGGAGTCGCTCGATTCGAAGCTGAAAACCGGGGCTTTGAAGAAGGAAGGTGACAATTTGGTCGTCGTTGGTACCCAGAGGCTCGGACCTGACCCGGATATGGTTCAGAAGCAGATCCGGATCGTGGATTTCAGGTCCGGACGCCAGGTTTACGCCGGATCGGCGTTCTCGGTGTCGCCATCGCCGACCGCGCTGCCCTTGCCGTCGTTTTCGAAGAAGCAGCCGGCGGTTGCGGTTGCCGACTCCGCGACCCGTGATCTCAGGCGTCTTCTTCGGCTTGAATGA

Predicted protein sequences of Glyma15g10710

Limit To All Plant Sequences

>Glyma15g10710.1   sequence type=predicted peptide   gene model=Glyma15g10710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTEVLRPQDCFTHRIAVPPAGFSRRRTSGTHNNNYFRGTRKPVTRPEQRKRVVEKRPSFDDSRFSRLEMEKVTILRRGESLDSKLKTGALKKEGDNLVVVGTQRLGPDPDMVQKQIRIVDFRSGRQVYAGSAFSVSPSPTALPLPSFSKKQPAVAVADSATRDLRRLLRLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain