Glyma15g10686 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g10686): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g10686): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g10686

Feature Type:	gene_model
Chromosome:	Gm15
Start:	7755978
stop:	7757636
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g10686

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G18910	AT	Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein \| chr5:6306994-6309396 REVERSE LENGTH=511	SoyBase	E_val: 3.00E-95	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0046777	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein autophosphorylation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF794	Panther		JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_G7IFN0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Somatic embryogenesis receptor kinase n=1 Tax=Medicago truncatula RepID=G7IFN0_MEDTR	SoyBase	E_val: 5.00E-111	ISS
UniRef100_UPI000233BD1E	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BD1E related cluster n=1 Tax=unknown RepID=UPI000233BD1E	SoyBase	E_val: 1.00E-137	ISS

Expression Patterns of Glyma15g10686

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g10686 not represented in the dataset	Glyma15g10686 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g10686 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g100100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g10686

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g10686

Limit To All Plant Sequences

>Glyma15g10686.1   sequence type=CDS   gene model=Glyma15g10686   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTAATCTTATACCAGATATCTGATTTTGGGCTTGCAAAGTGGTTACCTGACCAATGGACTCACCATACTGTCTCAAAAGTGGAAGGCACATTCGGCTACCTTCCTCCTGAATTCTTCATGCATGGTATAGTAGATGAAAAGACAGATGTCTATGCTTATGGTGTACTATTATTGGAGCTCATTACTGGTCGACAAGCTTTGGATAGCTCACAGAAAAGTCTGGTGATGTGGGCAAAACCTTTGCTAACTGCAAATAACATCAAAGAGCTTGTGGATCCAGTTTTGGCTGATGCTTATGATGAAGAGCAGATGAAGCTTGTAACCTTAACAGCTTCTCTCTGTGTAGACCAGTCCTCAATTCAGCGACCGGTTATGAGCCAGGTGTTAGATATACTAAGAGGGGAAGAAGAGAGCTTAAGAATCATGAAAGAACGATCGAAGTCAAAACTTCAGAGGACATACTCTGAAGAACTCTTAGATGCAGAAGAGTACAACTCAACAAAGTTTTTGAGTGAGAGGGATCGACATATGGAGACTATTCTAGGCTGCAGTAGCTCTGTTACAGAAGATGAGGATAAAATCTAG

Predicted protein sequences of Glyma15g10686

Limit To All Plant Sequences

>Glyma15g10686.1   sequence type=predicted peptide   gene model=Glyma15g10686   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLILYQISDFGLAKWLPDQWTHHTVSKVEGTFGYLPPEFFMHGIVDEKTDVYAYGVLLLELITGRQALDSSQKSLVMWAKPLLTANNIKELVDPVLADAYDEEQMKLVTLTASLCVDQSSIQRPVMSQVLDILRGEEESLRIMKERSKSKLQRTYSEELLDAEEYNSTKFLSERDRHMETILGCSSSVTEDEDKI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain