SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g10670

Feature Type:gene_model
Chromosome:Gm15
Start:7750168
stop:7754876
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g10670
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G18900AT Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr5:6304409-6306166 REVERSE LENGTH=298 SoyBaseE_val: 9.00E-158ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0018401GO-bp Annotation by Michelle Graham. GO Biological Process: peptidyl-proline hydroxylation to 4-hydroxy-L-proline SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016705GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0031418GO-mf Annotation by Michelle Graham. GO Molecular Function: L-ascorbic acid binding SoyBaseN/AISS
KOG1591 KOG Prolyl 4-hydroxylase alpha subunit JGI ISS
PTHR10869Panther PROLYL 4-HYDROXYLASE ALPHA SUBUNIT JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_G7IFM8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prolyl 4-hydroxylase alpha subunit-like protein n=1 Tax=Medicago truncatula RepID=G7IFM8_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1MF99UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MF99_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma15g10670
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g10670
ParalogEvidenceComments
Glyma13g28380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g10670 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g099900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g10670
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g10670
>Glyma15g10670.1   sequence type=CDS   gene model=Glyma15g10670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTAGTAGGGTTTGGTGTGTGGTGATGGCATCAGCGCTGGCGTTGATGTTGCAATGGCACGAAGCATTCAGCTCCTACGCTGGCTCCGCAAGTGCGATCATCGACCCTTCCAAGGTCAAACAAGTTTCGTGGAAACCGAGAGCTTTCGTTTACGAGGGTTTCCTGACGGAATTGGAATGCGATCACCTGATTTCCATCGCCAAATCGGAGCTGAAGAGATCCGCGGTGGCCGATAATTTGTCCGGCGAGAGCAAGCTGAGCGAAGTCAGAACGAGCTCCGGCATGTTCATTCCCAAGAACAAGGATCCAATTGTTGCTGGTGTAGAGGACAAGATTTCATCATGGACCCTTCTTCCAAAAGAAAATGGAGAAGACATACAAGTATTAAGATATGAGCACGGGCAAAAATATGATCCTCATTATGATTACTTTGCTGATAAAGTTAATATAGCTCGGGGTGGACACCGAGTTGCCACAGTTCTCATGTATCTCACTGATGTAACCAAAGGTGGTGAAACAGTGTTCCCTAATGCAGAGGAATCTCCACGTCACAGAGGTTCTGAAACAAAGGAAGATCTCTCTGAGTGTGCCCAAAAAGGAATAGCAGTGAAACCGCGAAGAGGGGATGCACTTCTTTTCTTTAGTCTCTACCCAAATGCTATCCCAGACACAATGAGTCTACATGCAGGATGCCCTGTAATTGAAGGTGAGAAATGGTCAGCAACAAAATGGATTCATGTGGACTCATTTGATAAGATGGTGGCAGATGGGGGGGATTGCAATGATAAGCAAGAAAACTGTGATAGATGGGCTACCCTTGGAGAATGCACTAGTAATCCCAATTATATGGTTGGATCACCAGGCCTTCCTGGCTACTGCATGAAAAGTTGCAAGGCATGTTAG
Predicted protein sequences of Glyma15g10670
>Glyma15g10670.1   sequence type=predicted peptide   gene model=Glyma15g10670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSRVWCVVMASALALMLQWHEAFSSYAGSASAIIDPSKVKQVSWKPRAFVYEGFLTELECDHLISIAKSELKRSAVADNLSGESKLSEVRTSSGMFIPKNKDPIVAGVEDKISSWTLLPKENGEDIQVLRYEHGQKYDPHYDYFADKVNIARGGHRVATVLMYLTDVTKGGETVFPNAEESPRHRGSETKEDLSECAQKGIAVKPRRGDALLFFSLYPNAIPDTMSLHAGCPVIEGEKWSATKWIHVDSFDKMVADGGDCNDKQENCDRWATLGECTSNPNYMVGSPGLPGYCMKSCKAC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo