Report for Sequence Feature Glyma15g10340
Feature Type: gene_model
Chromosome: Gm15
Start: 7491607
stop: 7492391
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g10340
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G18600 AT
Annotation by Michelle Graham. TAIR10: Thioredoxin superfamily protein | chr5:6183466-6183774 REVERSE LENGTH=102
SoyBase E_val: 2.00E-55 ISS
GO:0019243 GO-bp
Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate
SoyBase N/A ISS
GO:0045454 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0008794 GO-mf
Annotation by Michelle Graham. GO Molecular Function: arsenate reductase (glutaredoxin) activity
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
GO:0015035 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity
SoyBase N/A ISS
KOG1752
KOG
Glutaredoxin and related proteins
JGI ISS
PTHR10168 Panther
GLUTAREDOXIN
JGI ISS
PF00462 PFAM
Glutaredoxin
JGI ISS
UniRef100_G7IQ03 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Monothiol glutaredoxin-S2 n=1 Tax=Medicago truncatula RepID=G7IQ03_MEDTR
SoyBase E_val: 3.00E-59 ISS
UniRef100_I1MF53 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MF53_SOYBN
SoyBase E_val: 2.00E-68 ISS
Expression Patterns of Glyma15g10340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g10340
Paralog Evidence Comments
Glyma13g28750 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g10340 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g096600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g10340
Coding sequences of Glyma15g10340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g10340.1 sequence type=CDS gene model=Glyma15g10340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGATAGGGTGACACAGATGGCATCAGAGAGGCCAGTGGTGATATTCAGCAGAAGTTCATGCTGCATGTGCCACACCATCAAAACCCTCTTCAGTGACTTTGGAGTGCATCCAAATGTTCATGAACTTGATGAGATACCAAGAGGGAAGGACATTGAGCAAGCTCTTTCAAGGCTAGGGTGCAGCCCCTCTGTGCCTGCTGTGTTCATTGGTGGTGAGCTTGTTGGTGGAGCCAATGAAGTCATGAGCCTTCACCTTAACCGCTCCTTGATCCCTATGCTTAGGAGAGCAGGAGCTCTTTGGGTTTAA
Predicted protein sequences of Glyma15g10340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g10340.1 sequence type=predicted peptide gene model=Glyma15g10340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MDRVTQMASERPVVIFSRSSCCMCHTIKTLFSDFGVHPNVHELDEIPRGKDIEQALSRLGCSPSVPAVFIGGELVGGANEVMSLHLNRSLIPMLRRAGALWV*