SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g10020

Feature Type:gene_model
Chromosome:Gm15
Start:7230932
stop:7231921
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g10020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34585AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane, vacuole; EXPRESSED IN: 24 plant structures; EXPRESSED DURING: 15 growth stages; Has 43 Blast hits to 43 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 43; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr2:14568227-14568472 REVERSE LENGTH=81 SoyBaseE_val: 7.00E-18ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI000189D6E4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000189D6E4 related cluster n=1 Tax=unknown RepID=UPI000189D6E4 SoyBaseE_val: 3.00E-43ISS

Expression Patterns of Glyma15g10020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g10020
ParalogEvidenceComments
Glyma13g29020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g10020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g093500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g10020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g10020
>Glyma15g10020.1   sequence type=CDS   gene model=Glyma15g10020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCGATAACGAGCGCGGTGATAGCAGTGGTGGGAGTTCTTCTAGGTTGGATCACAATAGAGATTGCATGTAAACCCTGTCTTCAACAGGCTCGCCAAGCCATCGATCGGAATCTCAATCCAGATTACGATCCCGACGACGACGACGCCACCGCCATCCGCGCCCCACTCAACCCCGCCCCCACAGCAGCTTCCTCCGCCGCCGTCAAAGCCGTTTGA
Predicted protein sequences of Glyma15g10020
>Glyma15g10020.1   sequence type=predicted peptide   gene model=Glyma15g10020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAITSAVIAVVGVLLGWITIEIACKPCLQQARQAIDRNLNPDYDPDDDDATAIRAPLNPAPTAASSAAVKAV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo