|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G34640 | AT | Annotation by Michelle Graham. TAIR10: plastid transcriptionally active 12 | chr2:14582061-14584345 REVERSE LENGTH=527 | SoyBase | E_val: 3.00E-34 | ISS |
| GO:0008283 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell proliferation | SoyBase | N/A | ISS |
| GO:0042793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter | SoyBase | N/A | ISS |
| GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0009295 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleoid | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009508 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_G8Z259 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Hop-interacting protein THI030 n=1 Tax=Solanum lycopersicum RepID=G8Z259_SOLLC | SoyBase | E_val: 1.00E-37 | ISS |
| UniRef100_I1M1J3 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M1J3_SOYBN | SoyBase | E_val: 5.00E-43 | ISS |
|
Glyma15g09763 not represented in the dataset |
Glyma15g09763 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g09763.1 sequence type=CDS gene model=Glyma15g09763 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTGGAGTTTGGGGTGGAGATCCAGTTTACCCAACTGTGAACTATATTCAAGATCCAAATGAAGTGATTGACTACAGGGGGCCAGATTTTCATGAACCAATGCCAAATATGGTGGCTTATCTGAAGGAGCAAGGAAAACTCACTTCAAGGGAGGAATTTGACAAGATTATGGCTAAGGAAAAGACTGAACAAATTGAGTTGACGGAGATGGATGAAGCTATGGCCAAAGCTGTTGACATTTGA
>Glyma15g09763.1 sequence type=predicted peptide gene model=Glyma15g09763 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAGVWGGDPVYPTVNYIQDPNEVIDYRGPDFHEPMPNMVAYLKEQGKLTSREEFDKIMAKEKTEQIELTEMDEAMAKAVDI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||