Glyma15g09605 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g09605

Feature Type:	gene_model
Chromosome:	Gm15
Start:	6879887
stop:	6880583
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g09605

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G34340	AT	Annotation by Michelle Graham. TAIR10: Protein of unknown function, DUF584 \| chr2:14489032-14489442 REVERSE LENGTH=136	SoyBase	E_val: 1.00E-22	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF04520	PFAM	Protein of unknown function, DUF584	JGI		ISS
UniRef100_B6U7S5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear protein n=1 Tax=Zea mays RepID=B6U7S5_MAIZE	SoyBase	E_val: 9.00E-10	ISS
UniRef100_I1MEY9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MEY9_SOYBN	SoyBase	E_val: 1.00E-72	ISS

Expression Patterns of Glyma15g09605

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g09605 not represented in the dataset	Glyma15g09605 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g09605

Paralog	Evidence	Comments
Glyma13g29450	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g09605 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g089600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g09605

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g09605

Limit To All Plant Sequences

>Glyma15g09605.1   sequence type=CDS   gene model=Glyma15g09605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAGGAGTTCGTCGAATCCGAGGTTGTCTTTCCCGACCACCGCGCCGCCCACGACTGGGTAGTGGAGCTGGCGCCCCCGCCGCGGAGGGAGAGGGAGAATTGTCGACGGAGGGCGGCGAATTCGATGCCGGTGAGTATACCGGAGAGGACGGGCCGGCGGCACTGGGGCTCCGCCGAGGAGGAGGCGGAAGAGGAGGAGATGACGCCGCCGCACGAGATCGTGAAGAGGAGGGTGGCTGCAAAAATGGCGTTTTCGGTGTGCACGGGGAATGGGAGGACATTGAAGGGACGTGATTTGAGTCAGGTCAGGAATTCGATTCTCAGGTTAACTTATAAGAAAGCTCCATGCCCAAAGTTTCATACAAGCGAAGATGGGAAAATGGAAAATTTAAAAAGAAAAAGAAAAATTGTCTCCATTTCTTCATTTTTCTTGCTTTGTTATTTAATTGATTGGTTAATTGGGCTAGCTATTGAGATCGTTTTTGGAGTCTCGTTCATTGTAAAAGGGAACATTTGA

Predicted protein sequences of Glyma15g09605

Limit To All Plant Sequences

>Glyma15g09605.1   sequence type=predicted peptide   gene model=Glyma15g09605   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEEFVESEVVFPDHRAAHDWVVELAPPPRRERENCRRRAANSMPVSIPERTGRRHWGSAEEEAEEEEMTPPHEIVKRRVAAKMAFSVCTGNGRTLKGRDLSQVRNSILRLTYKKAPCPKFHTSEDGKMENLKRKRKIVSISSFFLLCYLIDWLIGLAIEIVFGVSFIVKGNI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain