SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g08860

Feature Type:gene_model
Chromosome:Gm15
Start:6264258
stop:6266252
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G34140AT Annotation by Michelle Graham. TAIR10: Dof-type zinc finger DNA-binding family protein | chr2:14414188-14414700 REVERSE LENGTH=170 SoyBaseE_val: 4.00E-42ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF02701PFAM Dof domain, zinc finger JGI ISS
UniRef100_B0EW02UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dof10 transcription factor n=1 Tax=Glycine max RepID=B0EW02_SOYBN SoyBaseE_val: 2.00E-90ISS
UniRef100_I1MER9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MER9_SOYBN SoyBaseE_val: 2.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g30331 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g082400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g08860.1   sequence type=CDS   gene model=Glyma15g08860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCGAGGAATCTCAAGGGATTAAGCTGTTTGGTGCGCTGATTACATTGAAGGGTGGGGAAGTAAAGAAAGGAGAAAAAGGAAGCGAATATGAGAGGGTGGAGAAGAGAGCAGAGAAGATAATACCCTGCCCGAGATGCAAGAGCATGGAAACTAAATTCTGTTACTTCAACAACTACAACGTTAATCAGCCGAGGCATTTTTGCAAGAGCTGCCAGAGGTACTGGACGGCTGGTGGGGCCCTCCGAAACGTCGCGGTCGGCGCCGGGCGCCGGAAGGCTAAGTCACCGTGCCATGGAGCCGGTGACTTCATGGATGGGCGTGCCTATGAAACTTCTGAAGATGAAAACAGGTTTGAGATGAATCAGGGACACGTTGCCATGCCCAACACTCATTTCCGCCAGATTTTTCAGGCCAAGCGCCAGAGAATCACCTCAGGAGCTCAGCATCAAGGTCAATGA

>Glyma15g08860.1   sequence type=predicted peptide   gene model=Glyma15g08860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGEESQGIKLFGALITLKGGEVKKGEKGSEYERVEKRAEKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKSCQRYWTAGGALRNVAVGAGRRKAKSPCHGAGDFMDGRAYETSEDENRFEMNQGHVAMPNTHFRQIFQAKRQRITSGAQHQGQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo