SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g08850

Feature Type:gene_model
Chromosome:Gm15
Start:6260254
stop:6261954
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g08850
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29140AT Annotation by Michelle Graham. TAIR10: Pollen Ole e 1 allergen and extensin family protein | chr1:10179029-10179811 FORWARD LENGTH=171 SoyBaseE_val: 9.00E-54ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF01190PFAM Pollen proteins Ole e I like JGI ISS
UniRef100_I1MER8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MER8_SOYBN SoyBaseE_val: 4.00E-120ISS
UniRef100_O49813UniRef Annotation by Michelle Graham. Most informative UniRef hit: Olee1-like protein n=1 Tax=Betula pendula RepID=OLEE1_BETPN SoyBaseE_val: 8.00E-58ISS

Expression Patterns of Glyma15g08850
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g08850
ParalogEvidenceComments
Glyma13g30340 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g08850 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g082300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g08850
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g08850
>Glyma15g08850.1   sequence type=CDS   gene model=Glyma15g08850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAAAAGCTGCAATCATCATCCTTGCCTCCACCCTTTGCTTCTTATCCTTCCTAGGCTCTGCTTATGCCCGAGACCGCTTCATGGTGGAGGGCACCGTTTACTGTGACACATGTCGCGTCCAATTCCTCACCAAGTTGTCCGAGATCCTTGAAGGTGCTACGGTGCGTGTGACGTGCTCACAAGTTGATAATGCGAAGAACGTGACATTCAGCAAAGAGGCAGTGACAGATGCTTCGGGGTCATACAAAGTGGAAGTGGAGGGAGACCACGAGGAAGACACGTGCGAGGTAACCCTTCTGAAGAGTCCAAGGCCAGACTGCTCGGAGATTGACCGAGAGTCTCACCTGCAACAGGCTGCCAGAATCAGCATCACCAAAAACAATGGAATAGTGTCCCCTCTTCGCCAAGCCAACCCTCTTGGTTTCCTCAAGAAGGACCGTCTCCCTGGCTGCGCTGACCTCCTCAAGGAGCTTGGAATCAACGAAGATGGCACTCTCTCCGTTTGA
Predicted protein sequences of Glyma15g08850
>Glyma15g08850.1   sequence type=predicted peptide   gene model=Glyma15g08850   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKAAIIILASTLCFLSFLGSAYARDRFMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKVEVEGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQANPLGFLKKDRLPGCADLLKELGINEDGTLSV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo