SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g08820

Feature Type:gene_model
Chromosome:Gm15
Start:6236132
stop:6238226
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g08820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G29070AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L34 | chr1:10149884-10151155 FORWARD LENGTH=157 SoyBaseE_val: 4.00E-33ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0042254GO-bp Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
PTHR14503Panther FAMILY NOT NAMED JGI ISS
PF00468PFAM Ribosomal protein L34 JGI ISS
UniRef100_I1MER5UniRef Annotation by Michelle Graham. Best UniRef hit: Ribosomal protein L34 n=1 Tax=Glycine max RepID=I1MER5_SOYBN SoyBaseE_val: 4.00E-92ISS
UniRef100_I1MER5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L34 n=1 Tax=Glycine max RepID=I1MER5_SOYBN SoyBaseE_val: 4.00E-92ISS

Expression Patterns of Glyma15g08820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g08820
ParalogEvidenceComments
Glyma13g30380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g08820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g082000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g08820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g08820
>Glyma15g08820.1   sequence type=CDS   gene model=Glyma15g08820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCGTTATCGCTTTGCATAGCCATGACAGCACCCACTCCCTCAGCTTCTCTCATTCTCACTGCCCCAAAACCATCTTCGCTCTCTTTGAACCTTACCCGCACTTGCTCCACCGCTCGCTCTCCGCTTCTCCATTGCTCCTTCCTCTCTTCTCCTTCCCTTCTCTCTCCCCCTTCCTCCATTTCAGGCTTGTCACTTGGATTGGATTTGACATCTAATTTTGGGACCAGAAGAGGAAAAGGTTCTGGCCTTGTTGTGAGGGCAGGCAAGGCTGCTCTTTGCCTGACTAAGAGAAGCAGATCAAGAAAATCATTGGCACGCACTCATGGTTTCCGCAAAAGAATGAGCACACCAGGTGGAAGAGCTGTTTTAAGGCGACGACGCGCCAAGGGACGGAGAGTCCTATGCACCAAGACGCATCCAAATAGTGGGAAATAG
Predicted protein sequences of Glyma15g08820
>Glyma15g08820.1   sequence type=predicted peptide   gene model=Glyma15g08820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASLSLCIAMTAPTPSASLILTAPKPSSLSLNLTRTCSTARSPLLHCSFLSSPSLLSPPSSISGLSLGLDLTSNFGTRRGKGSGLVVRAGKAALCLTKRSRSRKSLARTHGFRKRMSTPGGRAVLRRRRAKGRRVLCTKTHPNSGK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo