Glyma15g08430 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g08430

Feature Type:	gene_model
Chromosome:	Gm15
Start:	5969377
stop:	5973658
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g08430

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF11705	PFAM	DNA-directed RNA polymerase III subunit Rpc31	JGI		ISS
UniRef100_I1MEM9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MEM9_SOYBN	SoyBase	E_val: 9.00E-148	ISS
UniRef100_Q7Q0F1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AGAP012416-PA n=1 Tax=Anopheles gambiae RepID=Q7Q0F1_ANOGA	SoyBase	E_val: 4.00E-09	ISS

Expression Patterns of Glyma15g08430

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g08430

Paralog	Evidence	Comments
Glyma13g30880	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g08430 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g077800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g08430

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g08430

Limit To All Plant Sequences

>Glyma15g08430.2   sequence type=CDS   gene model=Glyma15g08430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGGCAGAGGGCGGGGACGGGGAGGATGGGGATGGGGACGAGGAGGTGGATTTAATACATTTGCCTCTCAAGTTCCATTTGATCTTTTTCCTGAGGCTGTTACTTTGCCTGATGTTAACCTTGATGATATTCATGATGATACCAAAAAGTTGCTTCGTTGGGATAGTCACCTTCAAAATTATTGGGAAGCCTCTCCTTATTTTCTCGAGGACAAAACCTCCAAGAAGAGGCAAAGTATGCACATAGCTAAATTCTCTGACAGGAAGAAGAACGATTTCACTCGTGACTCTCTCTCACAAGTTTTAATGTTCAATGATTTCCCTCAGGAGTTAGTTCAAGGTGCATCTAAGCGTGCGTCGAGAAGAAAAAAGTTTCGATGGAACCCAGAGTCAGAGATGAAGAAACTTGATTTCTTTGAACAACAAGAGAAAACAAACCAGGGCAAAGAGGAAAATGATGAAAATGAAAAGAAAGATGGAGAAGATGGAGACGAGGATGAAAATGCACAAGAGGAGGATGAAGAAGATATTAGTGATGATGATTATAATCAGAATATAGATTTTGATGACGATGAAGATGATTATAATGATGTAGATGACGGGGATGATGAACCTACCTATTAG

Predicted protein sequences of Glyma15g08430

Limit To All Plant Sequences

>Glyma15g08430.2   sequence type=predicted peptide   gene model=Glyma15g08430   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGRGRGRGGWGWGRGGGFNTFASQVPFDLFPEAVTLPDVNLDDIHDDTKKLLRWDSHLQNYWEASPYFLEDKTSKKRQSMHIAKFSDRKKNDFTRDSLSQVLMFNDFPQELVQGASKRASRRKKFRWNPESEMKKLDFFEQQEKTNQGKEENDENEKKDGEDGDEDENAQEEDEEDISDDDYNQNIDFDDDEDDYNDVDDGDDEPTY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain