Glyma15g07930 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g07930): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g07930

Feature Type:	gene_model
Chromosome:	Gm15
Start:	5585817
stop:	5588380
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g07930

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G27450	AT	Annotation by Michelle Graham. TAIR10: Aluminium induced protein with YGL and LRDR motifs \| chr4:13727665-13728683 REVERSE LENGTH=250	SoyBase	E_val: 4.00E-73	ISS
GO:0001666	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hypoxia	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR11772	Panther	ASPARAGINE SYNTHETASE	JGI		ISS
PF12481	PFAM	Aluminium induced protein	JGI		ISS
PF12504	PFAM	Aluminium induced protein	JGI		ISS
UniRef100_I1MEH7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MEH7_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q3HVL7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: TSJT1-like protein n=1 Tax=Solanum tuberosum RepID=Q3HVL7_SOLTU	SoyBase	E_val: 5.00E-116	ISS

Expression Patterns of Glyma15g07930

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g07930 not represented in the dataset	Glyma15g07930 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g07930 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g073100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g07930

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g07930

Limit To All Plant Sequences

>Glyma15g07930.1   sequence type=CDS   gene model=Glyma15g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGGCGGTGTTTGCAAAAGCCATTGGAAAACCACCGGAGGAACTGAGGCTTCCGGCAATGGGGTCCAATAATTCAAAGACCCCAGAAGAAATTGTACAGAAATTTCAATCTTTGTGGCCAGATTCTGCAGTTTACAACCTTCCACATGGGAATTTTATGGCTCTGTCTCATGAAGATGAAAGTCCAATACACCCCAGGTGTATTGTTGTTTTGGATGATATCTTCTGCATTTTTATGGGAGCTCTAGCAAACATAGCTGAGCTTAGACATCATTATGGGCTCCCAAGACAAGCAACAGAAGCCATGATTGTGATTGAAGCCTATAAGGCCCTAAGAGATCGCGCTCCCTACCCACCTGACCAAGTTGCTAAACATCTTGATGGAAAATTTGCATTCATCATCTTTGATGCCAAGACATATACTCTTTTTATAGCCAGGGATCGTGAAGGAAGTGTGAAATTTCAATGGGGAATGGCAAGAGATGGATCCTTAGTCTGTTCTGATGACCCTACAATCATCAGAGAGGGATGTGGACAAGCTTGTGCAGCTTTTCCTCCGGGGTGCATTTTCATCAATGGAAGTGGGTTGACAAGCTTTGATCATCCACTGCACAAGGTTCAAGCTGTTGCGCATGAAGATGACAGTGGAAACATCTTGAGTGTATATTTTCAGGTGGATTTGTACACAAAGATTCCCAGCATTCCTCGCACTGGAAGTGCTGCTAATTGGGCTGATGCAGTTGCTGAAGTCAAGGGAGAATAA

Predicted protein sequences of Glyma15g07930

Limit To All Plant Sequences

>Glyma15g07930.1   sequence type=predicted peptide   gene model=Glyma15g07930   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAVFAKAIGKPPEELRLPAMGSNNSKTPEEIVQKFQSLWPDSAVYNLPHGNFMALSHEDESPIHPRCIVVLDDIFCIFMGALANIAELRHHYGLPRQATEAMIVIEAYKALRDRAPYPPDQVAKHLDGKFAFIIFDAKTYTLFIARDREGSVKFQWGMARDGSLVCSDDPTIIREGCGQACAAFPPGCIFINGSGLTSFDHPLHKVQAVAHEDDSGNILSVYFQVDLYTKIPSIPRTGSAANWADAVAEVKGE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain