Glyma15g07900 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g07900

Feature Type:	gene_model
Chromosome:	Gm15
Start:	5561053
stop:	5563493
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g07900

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G04930	AT	Annotation by Michelle Graham. TAIR10: fatty acid desaturase family protein \| chr4:2509236-2510918 FORWARD LENGTH=332	SoyBase	E_val: 0	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0009827	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification	SoyBase	N/A	ISS
GO:0009860	GO-bp	Annotation by Michelle Graham. GO Biological Process: pollen tube growth	SoyBase	N/A	ISS
GO:0030148	GO-bp	Annotation by Michelle Graham. GO Biological Process: sphingolipid biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016705	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	SoyBase	N/A	ISS
GO:0042284	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sphingolipid delta-4 desaturase activity	SoyBase	N/A	ISS
KOG2987	KOG	Fatty acid desaturase	JGI		ISS
PTHR12879	Panther	SPHINGOLIPID DELTA 4 DESATURASE/C-4 HYDROXYLASE PROTEIN DES2	JGI		ISS
PF00487	PFAM	Fatty acid desaturase	JGI		ISS
PF08557	PFAM	Sphingolipid Delta4-desaturase (DES)	JGI		ISS
UniRef100_A2Q4Q7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Fatty acid desaturase; Peptidase M, neutral zinc metallopeptidases, zinc-binding site n=1 Tax=Medicago truncatula RepID=A2Q4Q7_MEDTR	SoyBase	E_val: 0	ISS
UniRef100_C6TIK0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TIK0_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g07900

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g07900

Paralog	Evidence	Comments
Glyma13g31440	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g07900 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g072800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g07900

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g07900

Limit To All Plant Sequences

>Glyma15g07900.1   sequence type=CDS   gene model=Glyma15g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGAGGAGAAGATCGAGAAGGGGTCGCAGTAGCCGGGGGCTTCTTCTGGTCCTACACAGACGAACCCCATGCCACACGACGTCGTCAGATCCTCTCCAAATACCCTCAAATCAAACAACTCTTTGGCCCCGACCACTCTGCTTTCTTCAAGATTAGTGGAGTTGTTCTGCTTCAGCTTGGTACGGGTGCTTTACTTCATGATGCTGGCTGGCTGAAGATATTTTTAGTAGCATACTTTTTTGGTTCTTTTCTCAACCACAATCTCTTTTTGGCTATCCACGAGTTGAGTCACAACCTGGCCTTCTCAACCCCAGTCTACAACCGTTGGTTGGGGATTTTTGCTAACCTCCCTATAGGTGTGCCCATGTCTGTTACCTTCCAAAAGTATCACTTGGAGCACCACCGCTTCCAAGGTGTAGATGGCATTGATATGGATGTCCCTAGCCTCACTGAAGTCCGTCTTGTGAAAAATATTATTGCAAAAACCATTTGGGTCTTTTTACAGCTCTTTTTTTATGCACTTAGACCTCTCTTTCTTAAGCCAAAGCCTCCTGGCATTTGGGAATTCATCAACTTCTCTGTTCAGATAGCACTTGATGTGTCAATGGTTTACTTTTTTGGCTGGAAAGCCCTTGCCTATTTGATACTTTCCACTTTTGTTGGTGGTGGGATGCATCCAATGGCTGGTCACTTCATTTCCGAGCATTATGTGTTCAATCCTGACCAGGAGACTTATTCTTACTATGGACCTCTGAATTATCTCACTTGGCATGTGGGATACCATAATGAACACCATGATTTCCCAAGAATTCCTGGAAACAAGCTTCACAAGGTGAAGGAGATTGCTCCAGAGTTTTATGATAATTTAGCGTCCTACAGATCTTGGAGCCAGATCATTTACATGTACATTATGGATCGAACAGTTGGACCTTTTAGCCGAATGAAGAGAAAATCCAGTAAAGCCGAATAG

Predicted protein sequences of Glyma15g07900

Limit To All Plant Sequences

>Glyma15g07900.1   sequence type=predicted peptide   gene model=Glyma15g07900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRGEDREGVAVAGGFFWSYTDEPHATRRRQILSKYPQIKQLFGPDHSAFFKISGVVLLQLGTGALLHDAGWLKIFLVAYFFGSFLNHNLFLAIHELSHNLAFSTPVYNRWLGIFANLPIGVPMSVTFQKYHLEHHRFQGVDGIDMDVPSLTEVRLVKNIIAKTIWVFLQLFFYALRPLFLKPKPPGIWEFINFSVQIALDVSMVYFFGWKALAYLILSTFVGGGMHPMAGHFISEHYVFNPDQETYSYYGPLNYLTWHVGYHNEHHDFPRIPGNKLHKVKEIAPEFYDNLASYRSWSQIIYMYIMDRTVGPFSRMKRKSSKAE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain