|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G47990 | AT | Annotation by Michelle Graham. TAIR10: transducin family protein / WD-40 repeat family protein | chr2:19637010-19638602 REVERSE LENGTH=530 | SoyBase | E_val: 3.00E-11 | ISS |
| GO:0000741 | GO-bp | Annotation by Michelle Graham. GO Biological Process: karyogamy | SoyBase | N/A | ISS |
| GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
| GO:0009553 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac development | SoyBase | N/A | ISS |
| GO:0009560 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation | SoyBase | N/A | ISS |
| GO:0009561 | GO-bp | Annotation by Michelle Graham. GO Biological Process: megagametogenesis | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005730 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleolus | SoyBase | N/A | ISS |
| GO:0080008 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| UniRef100_F6HQ31 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=F6HQ31_VITVI | SoyBase | E_val: 4.00E-14 | ISS |
| UniRef100_G7I2U5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: U3 small nucleolar RNA-associated protein-like protein n=2 Tax=Medicago truncatula RepID=G7I2U5_MEDTR | SoyBase | E_val: 2.00E-13 | ISS |
|
Glyma15g07841 not represented in the dataset |
Glyma15g07841 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g07841.1 sequence type=CDS gene model=Glyma15g07841 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATCACATCAGAAGACAAGGAGAGAATGCATGTGGTGGGGATTACTTTCTTGTGGGGCCCAAAAGGTTGAAGTTGACTGAGCATGACAAGCTGTTGAATAAGTTTTTAGGCACAGGGGAGCTCTGGTGTCTCTGTTGGGAAGGGATTATCCTGGGGAATGTGTTTGCTGTGATGGAGGAATTAGTGTCTAGGAGGAAATTGCTCAAGAAGTGTGTCTCCAACTTGGATTTGGAGAAGCTGGTACTTTTGTAA
>Glyma15g07841.1 sequence type=predicted peptide gene model=Glyma15g07841 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDHIRRQGENACGGDYFLVGPKRLKLTEHDKLLNKFLGTGELWCLCWEGIILGNVFAVMEELVSRRKLLKKCVSNLDLEKLVLL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||