SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g06816): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g06816): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g06816

Feature Type:gene_model
Chromosome:Gm15
Start:4790767
stop:4791570
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g06816
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G14580AT Annotation by Michelle Graham. TAIR10: basic pathogenesis-related protein 1 | chr2:6225703-6226188 REVERSE LENGTH=161 SoyBaseE_val: 3.00E-63ISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
KOG3017 KOG Defense-related protein containing SCP domain JGI ISS
PTHR10334Panther CYSTEINE-RICH SECRETORY PROTEIN (CRISP/SCP/TPX1)-RELATED JGI ISS
PF00188PFAM Cysteine-rich secretory protein family JGI ISS
UniRef100_I1ME55UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1ME55_SOYBN SoyBaseE_val: 1.00E-117ISS
UniRef100_Q9XFB4UniRef Annotation by Michelle Graham. Most informative UniRef hit: PR1a n=1 Tax=Glycine max RepID=Q9XFB4_SOYBN SoyBaseE_val: 5.00E-83ISS

Expression Patterns of Glyma15g06816
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g06816 not represented in the dataset
Glyma15g06816 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g06816 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g062700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g06816
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g06816
>Glyma15g06816.1   sequence type=CDS   gene model=Glyma15g06816   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCGGGGATTAAGGTTTCGTTTTCTGTGTTGTGTTTGTTAGGGTTAGTCATTGTGGGTGATCATGCTGCGTATGCTCAAGACTCACCAACAGACTTTGTTAATGCACACAACGCTGCAAGATCACAGGTTGGTGTTCCAAATATAGTTTGGGATGACACAGTTGCGGCTTTTGCACAGAACTATGCTAACCAACGCAAAGGTGACTGCAAACTTGTCCACTCTGGTGGTGATGGAAAATACGGGGAGAATCTTGCCGGAAGCACCGGTAACCTAAGTGGTACAAATGCAGTGAAATTGTGGGTTGATGAGAAATCCAAGTATGACTACAATTCCAACACGTGCGTTGGTGGGGAGTGCAGGCACTACACTCAGGTTGTTTGGAAAAACTCTGTGCGTCTTGGATGTGGAAAAGTAAGGTGTGACAATGGAGGCACTTTCATTACTTGCAACTATGCTCCTCCTGGCAACTATGTTGGCCAAAGACCCTACTAA
Predicted protein sequences of Glyma15g06816
>Glyma15g06816.1   sequence type=predicted peptide   gene model=Glyma15g06816   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSGIKVSFSVLCLLGLVIVGDHAAYAQDSPTDFVNAHNAARSQVGVPNIVWDDTVAAFAQNYANQRKGDCKLVHSGGDGKYGENLAGSTGNLSGTNAVKLWVDEKSKYDYNSNTCVGGECRHYTQVVWKNSVRLGCGKVRCDNGGTFITCNYAPPGNYVGQRPY*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo