Report for Sequence Feature Glyma15g06366
Feature Type: gene_model
Chromosome: Gm15
Start: 4505510
stop: 4508164
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g06366
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G38040 AT
Annotation by Michelle Graham. TAIR10: Exostosin family protein | chr4:17867501-17869131 FORWARD LENGTH=425
SoyBase E_val: 2.00E-48 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005768 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: endosome
SoyBase N/A ISS
GO:0005794 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus
SoyBase N/A ISS
GO:0005802 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0003824 GO-mf
Annotation by Michelle Graham. GO Molecular Function: catalytic activity
SoyBase N/A ISS
PTHR11062 Panther
EXOSTOSIN (HEPARAN SULFATE GLYCOSYLTRANSFERASE)-RELATED
JGI ISS
PTHR11062:SF31 Panther
JGI ISS
PF03016 PFAM
Exostosin family
JGI ISS
UniRef100_B9SA61 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Catalytic, putative n=1 Tax=Ricinus communis RepID=B9SA61_RICCO
SoyBase E_val: 7.00E-50 ISS
UniRef100_UPI000233B5FC UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233B5FC related cluster n=1 Tax=unknown RepID=UPI000233B5FC
SoyBase E_val: 8.00E-90 ISS
Expression Patterns of Glyma15g06366
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g06366
Paralog Evidence Comments
Glyma13g32950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g06366 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma15g06366
Coding sequences of Glyma15g06366
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g06366.1 sequence type=CDS gene model=Glyma15g06366 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAATATGCAGGGGTTGACTATCGAGCGTATGATTGATGAAGTAGAGAAGTATGTGGAGCACCTAAAGTTGAAGTACCCTTATTGGAACAGAACCTTGGGTGCTGATCACTTTTTTGTTACTTGTCACGATATCGGTGTCAAGGCTACTAAAGGAGTTCCACATCTGACGAAAAATTCAATTCGAGTGGCTTGTTCATCAAGTTATGACGACGATGATTATGTTCCACATAAGGATGTTACCCTCCCACAAGTTCAACTGCCATTTTTTCACCCTCCAGGAGAAAATGACATCAAGAATAGGAACACATTTGCTTTCTGGGCTGGTCGTTCTGATTCAAGATTGAAAGATGATCTAATGGCTATGTGGGACAATGATACTGAACTTGACATACAGAACAAGAGTTGA
Predicted protein sequences of Glyma15g06366
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g06366.1 sequence type=predicted peptide gene model=Glyma15g06366 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MNMQGLTIERMIDEVEKYVEHLKLKYPYWNRTLGADHFFVTCHDIGVKATKGVPHLTKNSIRVACSSSYDDDDYVPHKDVTLPQVQLPFFHPPGENDIKNRNTFAFWAGRSDSRLKDDLMAMWDNDTELDIQNKS*