Report for Sequence Feature Glyma15g06170
Feature Type: gene_model
Chromosome: Gm15
Start: 4363700
stop: 4367606
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g06170
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G51220 AT
Annotation by Michelle Graham. TAIR10: ubiquinol-cytochrome C chaperone family protein | chr5:20821405-20823125 REVERSE LENGTH=281
SoyBase E_val: 2.00E-133 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG2873
KOG
Ubiquinol cytochrome c reductase assembly protein CBP3
JGI ISS
PTHR12184 Panther
BASIC FGF-REPRESSED ZIC BINDING PROTEIN HOMOLOG (ZIC3-BINDING PROTEIN)
JGI ISS
PF03981 PFAM
Ubiquinol-cytochrome C chaperone
JGI ISS
UniRef100_G7IPM1 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ubiquinol-cytochrome c reductase complex chaperone CBP3-like protein n=1 Tax=Medicago truncatula RepID=G7IPM1_MEDTR
SoyBase E_val: 5.00E-152 ISS
UniRef100_I1MDZ1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MDZ1_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma15g06170
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma15g06170
Paralog Evidence Comments
Glyma08g18850 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g06170 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g056200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g06170
Coding sequences of Glyma15g06170
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g06170.1 sequence type=CDS gene model=Glyma15g06170 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTTGCGAAGATGGAGCAAAGCAGTTACTCCAATCTCCAAATTTGGATCGCAGAGTCATTTGAATTTCGTGAAGGACGTCTCGCGCCAAACCTACGCCGGGGTTGCACCCGCGCCAACGATAGAGGACAAACCTCACCGCCCCGTGGTTAACCTAGATAAAATGTTTTGGTCTAAACCCTGTTCGCTGGCCTTGCCCCGTGACTCACCCCTCAGAGTTGAAGAACCTGATTATCAGGGCATCAAGCGTTTAATGCTCAAACTCATGCTGTTTTATAGTAAGCAGAGCAAGTCAATTCGTGGGGCTAATGTTGTGTACCAAAGAATCATTTCTCAAGTTGATAAACCTCCCATTTATGAAGTGTTTAACTTGGAGAAAACATTCAAAACAACATTCTCTTTACTTGTGCTTCATATGTGGTTCTGTTTGCGTCGCTTGAAGCAAGAGGGAAAGGAGGGTGTTGAATTTGGCCAGTACCTTTATGAGATTTACAATCACGATGTGGAGCTAAGAGTGTCCAAAGCTGGAGTTAACCTACTACTGACTAAGTGGATGAAAGAGCTTGAGAAGATTTTTTATGGGAACATTGTTGCTTATGATACTGCCATACTTCTGGAAGCTAAACCGGGTGATTTTTCTAATGTTATATGGAGGAATATATTCTCTGAAGATGGTTCTTCAACACCAGATGCTGCTGCATCTCAATCAGTGCAGGCGATGGCCAGATATGCTCGCCGGGAAGTAAGTTGTATGACCTTAACAGATAAAGAAGCACTATTTTCAGGGAATTTTATGTTCACCTCTTTGAAGCATGAGAACACAAACGGAAAGGGGCCTCAATGA
Predicted protein sequences of Glyma15g06170
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g06170.1 sequence type=predicted peptide gene model=Glyma15g06170 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLRRWSKAVTPISKFGSQSHLNFVKDVSRQTYAGVAPAPTIEDKPHRPVVNLDKMFWSKPCSLALPRDSPLRVEEPDYQGIKRLMLKLMLFYSKQSKSIRGANVVYQRIISQVDKPPIYEVFNLEKTFKTTFSLLVLHMWFCLRRLKQEGKEGVEFGQYLYEIYNHDVELRVSKAGVNLLLTKWMKELEKIFYGNIVAYDTAILLEAKPGDFSNVIWRNIFSEDGSSTPDAAASQSVQAMARYARREVSCMTLTDKEALFSGNFMFTSLKHENTNGKGPQ*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
